KEGG   Burkholderia sp. YI23: BYI23_D001600
Entry
BYI23_D001600     CDS       T01711                                 

Definition
(GenBank) type VI secretion system lysozyme
  KO
K11897  type VI secretion system protein ImpF
Organism
byi  Burkholderia sp. YI23
Brite
KEGG Orthology (KO) [BR:byi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:byi02044]
    BYI23_D001600
Secretion system [BR:byi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BYI23_D001600
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AET93670
Position
byi_1p:complement(199504..199992)
AA seq 162 aa
MNEPSAADRLQPSLLDRLIDDDPAAERFMTHRSLRAAVLRDVSWLFNTTNLGGAIEEEHF
PHAFASVLNYGLPCLSGRFASTIDTVLLEQAIRQAIERFEPRIDPSTLEIEPVLDRSVLD
MHNQIALVIRGLLWAQPVPLEFALRTQIDLEEGGITVMELPR
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaacgaacccagcgccgccgaccggctccagccgtcgctgctcgatcgcctgatcgac
gacgatcccgccgccgagcgcttcatgacgcatcgcagtctgcgcgccgcggtgctgcgc
gacgtgtcgtggcttttcaacacgaccaacctcggcggcgcgatcgaggaagaacacttc
ccgcacgcgttcgcctcggtgctcaactacggcttgccgtgcctgtcgggacgcttcgca
tcgaccatcgacacggtgttgctcgaacaggcgatccgtcaggcgatcgagcgcttcgag
ccgcgcatcgatccttcgacgctggagatcgaacccgtgctcgaccgctccgtgctcgac
atgcacaaccagatcgcgctcgtgatccgcggcctgctgtgggcgcagccggtgccgctc
gaattcgcgctgcgcacgcagatcgatctggaagaaggcggcatcaccgtgatggaactg
ccgcgctga

DBGET integrated database retrieval system