KEGG   Burkholderia sp. YI23: BYI23_D003430
Entry
BYI23_D003430     CDS       T01711                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
byi  Burkholderia sp. YI23
Pathway
byi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:byi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BYI23_D003430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:byi02044]
    BYI23_D003430
Secretion system [BR:byi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BYI23_D003430
SSDB
Motif
Pfam: Phage_GPD ALO
Other DBs
NCBI-ProteinID: AET93853
Position
byi_1p:411970..412800
AA seq 276 aa
MSMVLPSQAYSLVLKPQPAPISVLRWSCEAAISQLYKYTVEFTSAVDISKDEVVGRPATF
SVEPEDPSAGHLQQMFGERWKDFSKMPKRYDTHGIIQQFEVLGTSADETRYRVTLAPKIA
DLSRVRKSRLFQKQSVVEIITDTLRHYGYRLGVDFDFLKLRGKYKRHEYITQYNESTFGF
VQRLCAEEGLWFRFEQKHDRTIIVFGDDLDAYARKQRIIPYRSHSGLESAGDESIRSLRT
ITQRVPEAIQLNDYNHRQADVNLLVEANAAPADKNP
NT seq 831 nt   +upstreamnt  +downstreamnt
atgtcgatggtgttaccgagtcaggcatacagcctggtcctcaaaccacaacccgcgccc
atatccgtattgcgctggtcgtgcgaagctgctatcagccagctctacaagtacacggtc
gagttcacgagcgccgtggatatctcgaaggatgaggttgtgggacggcccgcgacattc
agcgtcgagcccgaggacccctcagcaggccatttgcagcaaatgttcggcgagcgctgg
aaagacttcagcaagatgcccaaacgctatgacacgcatgggatcatccagcaattcgag
gtactcggaacatcggccgatgaaacgcggtatcgcgtcacgctggcgccgaaaatagct
gatttgtcaagagttcgaaaaagcagactattccaaaagcaaagcgttgtcgagatcatt
accgacaccctgcgtcactacggctatcgcttgggcgtggactttgatttcctcaagctg
cgcggcaagtacaaacgtcacgaatatatcactcagtataacgaatcgaccttcggattc
gtacaacggctctgtgctgaagaggggttgtggttccggttcgagcaaaagcacgatcga
acgatcatcgtctttggcgatgatctggatgcctacgccagaaagcagcggatcattccc
tatcgcagccactcgggcctcgaaagcgcgggtgacgagtcgatccgctcgctcaggacg
attacgcagcgcgtgcccgaagcgatccagttgaatgactacaaccatcgtcaggcggat
gtgaacctgctggtggaggcgaacgctgcaccggcggataagaacccttaa

DBGET integrated database retrieval system