KEGG   Burkholderia sp. YI23: BYI23_D003450
Entry
BYI23_D003450     CDS       T01711                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
byi  Burkholderia sp. YI23
Pathway
byi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:byi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BYI23_D003450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:byi02044]
    BYI23_D003450
Secretion system [BR:byi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BYI23_D003450
SSDB
Motif
Pfam: DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1
Other DBs
NCBI-ProteinID: AET93855
Position
byi_1p:413760..415541
AA seq 593 aa
MARRRHEEHLATQISYRGRGNPFSLEIGEVVGLDVNPMDAPHGLFVTSIRCGGGRAVSYW
CAFRAIPADRRWRTSIESVKRPKIEGVLPARIDSPGKYTYSYVTEKGLYVVKMPFDLDEW
SPGGRSRAIRMMRPYAGANYGHHFPLIDGAKVALIFTAQDPDRPVIAGSLHDSLNPDLVN
NLNHTRNILRTAALNEMRMEDKRGFEHIHLTTPFQTSELNLGHMVDGDRKERGRGAELRS
DEHIALRGGKGVFISADTQNAAGGKQLDMQPAQALLEQALLQTQSLAEAAKAAQAIAADY
ENQKALLDGTLRELKNAAVVVSAPAGVGVASGDHLQLSAAKNLIVTAGGNADIGVLRRFT
VAAGEAVSIFAQRLGMKLIAKGKVEVQSQGDEMELSALKDVTISSVDGRLVLSAAKEVWI
GAGGSYIKINGNRIENGTPGDILEKCAVWSKPSAASAQISSTLPNALPSERLVLNLASSP
SAMAAVPQDVPYKLYAQGALVAQGLTDPSGRILVDHEPSTQSYRLELANGVTYNIPVSEE
FRGDAENGQLANQGFHFFEQGSNGDGHDRAVHRKTYYGLLNPATETSATEPQS
NT seq 1782 nt   +upstreamnt  +downstreamnt
atcgcacgccggcgtcacgaagagcatctggctacgcagattagttatcgggggcgtggg
aatccgttttcgctcgaaatcggcgaggtggttggcctcgacgtgaacccgatggatgcg
ccgcacggtctttttgtgacatcgatccgatgcggcggcggccgggccgtgtcgtactgg
tgcgcgtttcgggcgattccggcggatcgcagatggcggaccagcatcgaatcggtcaag
cgtccgaaaattgaaggcgtgttgcccgcgcgaatcgattcgccgggaaaatacacctat
agctatgtgaccgagaaaggcctgtacgtcgtcaagatgccgttcgatctggacgagtgg
agtccgggcgggcgcagccgtgcgatccgcatgatgaggccgtatgcgggggcgaactac
gggcatcatttcccgctgatcgacggggccaaagttgcgctgatcttcactgcgcaagac
ccggataggccagtgatagccgggtcacttcatgacagcctgaatcccgatctcgtcaat
aaccttaaccatacgcgaaatatccttcgcacagcggcgctcaatgagatgcgcatggag
gataagcgagggtttgagcatattcacctgaccacgccgttccagaccagcgaactgaat
ctggggcacatggtcgatggagatcgcaaggagagggggcgcggcgcggagctgaggagc
gacgagcacatagcgctgagagggggtaaaggtgtgttcatctcggccgatacgcagaat
gctgcgggcggcaaacagcttgacatgcaaccagctcaagccctgctcgaacaggcgttg
ttgcagacgcagtccctcgcggaagctgccaaggcggcacaggctattgcagcagactac
gagaatcagaaggcgctgcttgacggtacgctgcgcgaactgaagaatgcggccgtggtc
gtcagcgctccagcgggtgtgggtgtcgcatcgggcgatcatctgcagctaagcgcagcg
aagaaccttattgtcacagcgggcgggaatgccgatatcggcgtgttgcgacgtttcact
gtcgcggcgggcgaagctgtgtcgatcttcgcgcaacggctggggatgaagctgatcgcc
aagggcaaagtcgaggtgcagtcgcaaggcgacgagatggagctgtcggcgcttaaggac
gtcacgatttccagcgtggacggtcgactcgttctttccgcagcgaaggaggtctggatc
ggcgcgggcggttcgtatatcaagatcaacggcaatcgcatcgaaaatgggacaccaggc
gatattcttgagaagtgcgcggtgtggagcaaaccgagtgcggcgtcggcgcagatcagc
agcactttgccgaatgcccttccgtccgagcgactcgtccttaacttggcatcgtcccct
tcggcgatggcagccgttccgcaggacgttccctacaaactctatgcgcagggcgctttg
gtcgcacaaggattgactgacccgtctggacgcattctcgttgaccacgagccaagcaca
cagtcctatcggctggagttggcaaacggtgtgacctacaacatccccgtaagcgaagag
tttcgcggtgacgctgaaaacggtcaattggcgaatcaaggctttcatttcttcgagcaa
ggatcaaacggggatggccacgatcgcgccgttcaccgcaagacttactacggtcttttg
aatcccgctaccgaaacctcagctacggaaccgcaatcatga

DBGET integrated database retrieval system