KEGG   Burkholderia sp. YI23: BYI23_D003500
Entry
BYI23_D003500     CDS       T01711                                 

Definition
(GenBank) PAAR motif-containing protein
Organism
byi  Burkholderia sp. YI23
SSDB
Motif
Pfam: PAAR_motif MaoC_dehydrat_N
Other DBs
NCBI-ProteinID: AET93860
Position
byi_1p:421405..421656
AA seq 83 aa
MPNLILLGDATDHGGRVITASTTMIYEGRGVARKGDEVSCPKHLESKPNLIIDGDEETLD
EGVPVARHGNRAMCGCHLISSLL
NT seq 252 nt   +upstreamnt  +downstreamnt
atgcctaacctgattctcctcggcgacgccaccgaccacggtggccgcgtcatcaccgca
tcgaccacgatgatctacgaaggacgcggcgtggcgcgcaagggcgatgaagtgagctgc
ccgaaacatcttgagagcaaaccgaacctcatcatcgacggtgacgaagagacgctggac
gaaggcgtgcccgtcgcccgccacggcaatcgcgcgatgtgtggatgccacctcatctcc
agtctgctctga

DBGET integrated database retrieval system