KEGG   Burkholderia sp. YI23: BYI23_D003530
Entry
BYI23_D003530     CDS       T01711                                 

Definition
(GenBank) type VI secretion protein
  KO
K11896  type VI secretion system protein ImpG
Organism
byi  Burkholderia sp. YI23
Brite
KEGG Orthology (KO) [BR:byi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:byi02044]
    BYI23_D003530
Secretion system [BR:byi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BYI23_D003530
SSDB
Motif
Pfam: T6SS_TssF Glyco_hydro_76
Other DBs
NCBI-ProteinID: AET93863
Position
byi_1p:426428..428260
AA seq 610 aa
MNDDIDQDVHHPDPVLRYYEAEMRYLREAGREFARAHPDRARMLNLDRVGDRDPYVERLY
EGFAFLTGRLHQKLDDELPELTEGLVSLLWPHYLRMIPSLSVVELIPLGEKHQRTEHVPA
GVPVRSAPIGVPKEGETATHRTVQCLYRTTQPVELHPLRLLQAGATVRHDGRSVIRLAFE
LDHSANRKETDLSRLRLYLNADQPTAFAMHLALTRQVHAMEWRIPEIRDGEALPLQGVTI
EPAGFSPEERLWPKSDAAFSGYQLLLEYFTFREKFLFVDLCGLDVEKLPEDSTRFELEIV
LTHPYPSDQRFNKDNVRLFCTPVINLFELDAEPIVIDHHETEYRVVPAGYQGEHVETYSV
DAVEAFDHVTSERYEYVPFATFRHRGGMMRHESPERYFHTRVRPGMDGLHETWVIFGGNA
WETMQDLPEESVSLHVTGTNGMLPRKGLREARIDELAASTPNVAGVRNLIAPTLPLYPPT
GDRFQWRVLSHLAPNFLSMMNAEVLRGALALYDWTHDELNRRRLAGILHVSEALLEEVTG
GAVERGVLIEVTLDSHAFSGEGDVMLFGELLHRFFELYAEINLFTKLAIVSLPSQARIEW
PRSKTWRAPL
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgaacgacgatatcgaccaggacgtccaccatcccgatcccgttctacgctactacgaa
gccgaaatgcgctatctgcgcgaggcgggacgtgagttcgcgcgcgcgcatccggaccgc
gcacgcatgcttaatctcgatcgcgtcggcgaccgcgatccgtacgtcgaacgactctat
gaaggcttcgcgttcctgaccggccgtctccaccaaaagctcgacgacgagctgccggaa
ctgaccgaaggtctcgtgagcctgctatggccgcactatctgcggatgattccgtcgctc
tcggtggtcgagctgatcccgctcggagaaaagcaccagcgcaccgaacacgtgccggcg
ggcgtcccagtgcgctcggcgccgatcggcgtgcccaaagagggcgaaacggcgacgcac
cgaaccgtccagtgcctgtatcgcacgacgcagccggtcgaattgcacccgctgcgcttg
ctccaggccggcgccacggtgcgtcacgacggccgctcggtgatccggctggccttcgaa
ctggatcactccgcgaaccggaaggaaacagatctatcgcgcctgcgcctctatctgaac
gcagaccaaccgacggccttcgcgatgcacctcgcgctcacccgtcaggtccacgcgatg
gaatggcgcatccccgaaatccgcgacggcgaagcgttgccgctgcaaggcgtgacgatc
gaaccagccggcttctcgcctgaagagcgcctctggcccaaatccgacgccgccttctcc
ggctatcagttgctgctcgaatacttcaccttccgcgagaaattcctgttcgtcgatcta
tgcggactggatgtcgaaaagcttccggaggactcgacgcgcttcgaactggagatcgtg
ctcacacatccgtatccgtccgatcagcgcttcaacaaggacaacgtgcgcctcttctgc
acgcccgtcatcaacctgttcgaactcgatgcggagcccatcgtcatcgatcatcacgag
acggagtatcgcgtggtgcctgcgggctatcagggcgaacacgtcgaaacctattccgtc
gatgcggtcgaagcgttcgatcacgtgacctccgagcgctacgagtacgtgccgttcgcg
accttccggcatcgcggcggcatgatgcgccatgaatcgcccgaacgttactttcatacg
cgcgtgcgccccggcatggatggactgcatgaaacgtgggtgatcttcggcggcaacgcg
tgggagacgatgcaggatttgcctgaagaaagcgtgtcattgcacgtcactggcacgaac
ggcatgttgccgcgcaagggcttgcgcgaggcacgcatcgacgagttggcggcgagcacg
ccgaacgtcgcgggcgtgcgcaatctcatcgcgccgaccttgccgctctatccgccgacg
ggcgaccgtttccagtggcgcgtgctctcgcatctcgcgccgaacttcttgtcgatgatg
aacgcggaagtgctgcgcggtgcgctcgcgctctacgactggacccacgatgaactgaat
cgccggcggctcgcgggcatcctgcacgtatccgaagcgttgctcgaagaagtcacgggc
ggcgcggtggagcgcggcgtgcttatcgaagtgacgctcgattcgcacgcgttctcgggc
gagggcgatgtgatgctcttcggtgaactgctgcatcgcttcttcgagttgtacgcggag
atcaatctctttacgaaactcgctatcgtgagcctgccctcgcaggcccgcatcgaatgg
ccgcgcagcaagacgtggagagcgccgctatga

DBGET integrated database retrieval system