KEGG   Burkholderia sp. YI23: BYI23_D008410Help
Entry
BYI23_D008410     CDS       T01711                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00040  Pentose and glucuronate interconversions
byi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BYI23_D008410
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BYI23_D008410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: AET94351
UniProt: G8MNG2
Position
byi_1p:complement(959354..960391)
Genome map
AA seq 345 aa AA seqDB search
MEALVLEEAKRISLRPFSLPQVVGPRDVRIKIHTVGICGSDIHYYQHGRIGPFVVNEPMV
LGHEASGTVVEVGDEVKHLKAGDRVCMEPGVPDMESRASREGLYNLDPKVRFWATPPVHG
CLAPYVVHPAAFTYKLPDNVSFAEGAIVEPLSIGLQAAKKAAIKPGDVAVVLGAGTIGMM
CALAALAGGCSRAIVCDLVPEKLELIGGVQGVTAVNIRDKRVLDVVHELTDGWGANIVFE
ASGNEKAFDGIVDLLCPGGCLVLVGMPQHAIPLDVVAVQIKEARIESVFRYANIFPRAIQ
LIASGKLDVKPFISRTFPFAEGIKAFEEAASGVPTDVKVQIVLEA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggaagcactggttctcgaggaagcgaaacgcatcagcttgcgtccgttcagcttgccg
caggtcgtggggccgcgcgacgtgcgcatcaagattcatacggtgggcatttgcggcagc
gacattcattactatcagcatggccgcatcgggccgttcgtcgtgaacgagccgatggtg
ctcgggcacgaagcatcgggcacggtcgtcgaggtcggcgacgaggtgaagcatctgaag
gcgggcgatcgcgtgtgcatggagccgggcgtgccggacatggaatcgcgcgcgtcgcgc
gaaggcctctataacctcgatcccaaagtgcgcttctgggcgacgccgcccgtgcacggc
tgcctcgcgccctacgtcgtgcacccggctgcgttcacctacaagctgcccgataacgtg
agcttcgcggaaggcgcgatcgtcgagccgctatccatcggcttgcaggccgcgaagaag
gccgcgatcaagccgggcgacgttgccgtcgtgttgggcgcgggcaccatcggcatgatg
tgcgcgctggccgcgctcgcgggcggatgcagccgcgcgatcgtgtgcgatctcgtgcct
gagaagctcgaactcatcggcggcgtgcagggcgtgaccgcggtgaatatccgcgataaa
cgcgtgctcgacgtggtgcatgaactgaccgatggctggggcgcgaacatcgtgttcgag
gcgagcggcaacgaaaaggcattcgacggcatcgtcgatctgctgtgcccgggcggctgt
ctcgtgctcgtcggcatgccgcagcatgcgattcctctcgatgtcgtcgcggtccagatc
aaggaagcgcgcatcgaatccgtgttccgttacgcgaatatcttcccgcgcgcgatccag
ttgatcgcatcgggcaagctcgacgtgaagccgttcatctcgcgcacgttcccgttcgcg
gaaggcatcaaggctttcgaggaagcggcgagcggtgtgccgaccgacgtgaaggtgcag
atcgtactggaagcgtga

DBGET integrated database retrieval system