KEGG   Burkholderia sp. YI23: BYI23_D010000Help
Entry
BYI23_D010000     CDS       T01711                                 

Definition
(GenBank) NUDIX hydrolase
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00760  Nicotinate and nicotinamide metabolism
byi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BYI23_D010000
Enzymes [BR:byi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     BYI23_D010000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX-like zf-NADH-PPase DZR Nudix_N_2
Motif
Other DBs
NCBI-ProteinID: AET94510
UniProt: G8MNX1
Position
byi_1p:1150605..1151531
Genome map
AA seq 308 aa AA seqDB search
MPTPPHAIGFTLDPLDRVSEKRDDDGFVAGLSADPATRFLLFVNNVPLFKRAGGHDPLFS
AQEAATLGAPLQTVFLGRDAQARALFALSFDSGAQSLPEESAIEAIELRPIAMQGLVPPS
MVSALGEARSMLDWHRRHRFCANCGQPTDSGGAGWRRICANCKAQHFPRVDPVVIMLVTD
GERCLLGRQPQFLPGMYSALAGFVEPGETFEHAVYREVLEEAGIRCTDVRYYASQPWPFP
SSLMIGCFARAASTEIVVDKNELEDARWFTRKEVGAMLDGTHEHGLSAPKPFAIAHHLLK
AFATGELD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgccgcctcatgccatcggttttacgctcgatccgctcgatcgcgtgtcggaa
aagcgcgacgacgacggcttcgtcgccggtctgagcgccgatccggccacgcgttttctg
cttttcgtgaacaacgtgccgctcttcaagcgcgcgggcggccacgatccgcttttcagc
gcgcaggaagcggccacgctcggcgcgccgctgcaaaccgtgtttctcggccgcgacgcg
caagcacgcgcgctcttcgccctgtctttcgatagcggcgcgcagagcctgcccgaggaa
tcggcgatcgaagcgatcgagttgcgccccatcgcgatgcaaggcctcgtgccgccgtcg
atggtcagcgcgctcggcgaggcgcgttcgatgctcgactggcatcggcggcatcgcttc
tgcgcgaactgcggccagccgaccgattcggggggcgcgggctggcggcgcatctgcgcg
aattgcaaggcgcagcattttccgcgcgtcgatccggtcgtcatcatgctcgtcaccgat
ggcgaacgctgtctgctgggccgtcagccgcagtttctgccgggcatgtactcggcgctc
gcgggtttcgtcgaaccgggcgagacgttcgagcatgcggtgtatcgcgaggtgctggaa
gaagcgggcatccgctgcacggacgtgcgctattacgcatcgcagccgtggccgtttccg
tcctcgctgatgatcggctgtttcgcgcgcgcggcgagtacggagatcgtcgtcgacaag
aacgaactggaggatgcgcgctggttcacgcgcaaggaagtcggcgcgatgctcgacggc
acgcacgaacacgggctctcggcgccgaagccgttcgcgatcgcgcatcatctgttgaaa
gcgttcgcgacgggcgaactcgactag

DBGET integrated database retrieval system