KEGG   Burkholderia sp. YI23: BYI23_D011430Help
Entry
BYI23_D011430     CDS       T01711                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00010  Glycolysis / Gluconeogenesis
byi00020  Citrate cycle (TCA cycle)
byi00620  Pyruvate metabolism
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
byi01130  Biosynthesis of antibiotics
byi01200  Carbon metabolism
Module
byi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BYI23_D011430
   00020 Citrate cycle (TCA cycle)
    BYI23_D011430
   00620 Pyruvate metabolism
    BYI23_D011430
Enzymes [BR:byi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BYI23_D011430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Biotin_lipoyl Esterase Abhydrolase_5 Ser_hydrolase DLH PGAP1 Thioesterase Ndr Abhydrolase_3 DUF915 BAAT_C DUF1057
Motif
Other DBs
NCBI-ProteinID: AET94653
UniProt: G8MJL3
Position
byi_1p:1304871..1305995
Genome map
AA seq 374 aa AA seqDB search
MAAITPIVMPKWGLSMKEGTVNEWLVEEGTEITVGMPILDVETDKIANAVEAPDAGLLRR
RVAAAGDVLPVKALLGVLAPSSVSDAEIDEYVSSYVTPADDEEEGEEAAAYHFVDVDGIR
VRYASRGGDDAARSAVLFLHGFGGDLDNWLFNLDALAEKNRVFALDLPGHGQSTPNVPGT
SLAALASFVGKFMDAVGIERAHLVGHSMGGGIAAQMAVDSPARVQSVSLISPAGFGDEVN
NAYTEGFVTAESRRELKPVVELLFANPELVSRQMLDDLLKYKRLDGVSDALTSLNAGLFA
GGKQSAQPGGQLAESGKPVLVIWGAKDQIIPAAHAKNAPQGATVKVFDDAGHMSQMEKAN
EVNALLKEQVGKGG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaatcacaccgatcgtcatgcctaagtggggcttgtcgatgaaggaaggcacg
gtcaacgaatggctcgtggaggagggcacggagattaccgtcggcatgccgattctcgat
gtcgaaaccgacaagatcgccaacgcggtcgaagcgcccgatgcgggtctgctacggcgg
cgggtcgcggcggcgggcgatgtgctgccggtgaaagcgttgctcggcgtgctcgcgcct
tcttcagtgagcgatgcggaaatagacgagtacgtgtcgtcctacgtcacgcccgccgac
gacgaggaagaaggcgaagaagcggcggcgtatcacttcgtcgatgtggacggtatccgc
gtgcgctacgcctcgcgcggcggcgacgatgcggcgcgttcagcggtgctgtttcttcac
ggcttcggcggcgatctcgacaactggctattcaacctcgacgcattggccgaaaagaac
cgcgtgttcgcgctggacttgccgggccacgggcaatccacgccgaacgtgccggggacg
tcgcttgcggcgctggcgtcgttcgtcggcaagttcatggacgcggtcggcatcgagcga
gcgcatctcgtcggccattcgatgggcggcggcatcgcggcgcagatggccgtcgattcg
cccgcgcgcgtgcaatcggtgtcgctgatatcgcccgccggtttcggcgacgaagtgaac
aatgcgtacaccgaaggcttcgtcacggcagagtcgcgtcgcgaactgaagccggtggtc
gaactgttgttcgcgaatcccgaactggtgagccgccagatgctcgacgatctcctgaag
tacaagcggctcgacggcgtgtcggacgcgctgacatcgctcaatgcgggattgttcgcg
ggcgggaaacaaagcgcgcagccgggcggacagctcgcggaatcgggcaagccggttttg
gtcatctggggtgcaaaggaccagatcattccggccgcgcacgcgaaaaatgcgcctcaa
ggcgcgaccgtgaaagtgttcgacgatgccgggcacatgagccagatggagaaggcgaac
gaggtgaacgcgttgctgaaggagcaggtgggcaagggcggctga

DBGET integrated database retrieval system