KEGG   Burkholderia sp. YI23: BYI23_E003890Help
Entry
BYI23_E003890     CDS       T01711                                 

Definition
(GenBank) para-nitrophenol 4-monooxygenase
  KO
K21725  4-nitrocatechol/4-nitrophenol 4-monooxygenase [EC:1.14.13.166 1.14.13.167]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00627  Aminobenzoate degradation
byi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BYI23_E003890
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.166  4-nitrocatechol 4-monooxygenase
     BYI23_E003890
    1.14.13.167  4-nitrophenol 4-monooxygenase
     BYI23_E003890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Pyr_redox Pyr_redox_2 DAO Amino_oxidase Lycopene_cycl Pyr_redox_3 NAD_binding_8 HI0933_like Thi4 FAD_oxidored FAD_binding_2 Trp_halogenase NAD_binding_7 GIDA
Motif
Other DBs
NCBI-ProteinID: AET95550
UniProt: G8MQD5
Position
byi_2p:complement(353792..355006)
Genome map
AA seq 404 aa AA seqDB search
METLEGVVVVGGGPVGLLTALKLGRAGVKVVVLESESGVSPSPRAVAYMPPTIAAMDRFG
VLEDIRKRAVYCPSINYRHGDGTLFSTLEWSAVADDTEFPYMLLLGQNHVSNVIKQHLQT
LPNVDIRWNHRVESIDQDANYVTIETRCPGGVSRLRARWVAATDGARSTVREKIGLTFDG
LTWNERLVATNVFYDFTLHGYSRANFVHDPLDWAVVVQLDQSGLWRVCYGEDPSISMEEV
RRRMPERFKRLLPGAPTPDRYRVDHLNPYRVHQRCAAEFRRGRVILAGDAAHATNPMGGL
GLSGGVLDAEHLGRALISVINESAPVKVLDDYSVDRRKVFLEFTSPTATQNFNWMKESDP
AQRARDTELLTHAGTDRAVMREFLLSFEKLNGSSRPAPPLKLAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgcttgaaggagtcgtggttgttggtggaggtccggtcggcctgctcaccgct
ctcaaacttggtcgtgctggcgtgaaggtcgtcgtgcttgagtcggaatctggcgtttcg
ccgtcgccgcgcgccgtcgcgtacatgccgcctaccatcgctgcgatggaccgattcggc
gtgctcgaggacatccgcaagcgcgcagtctattgcccgagcatcaactatcgtcacggc
gacggtacgctcttcagtacgcttgaatggagcgctgtggcggacgacaccgaatttccc
tacatgctgttgctgggccagaaccacgtgtccaacgtcatcaagcagcaccttcaaacg
ttgcccaacgtcgatattcgctggaatcaccgcgtcgagagcatcgatcaggatgcgaac
tatgtgacgatcgaaacgcgttgcccgggcggcgtctcgcgactgcgcgcgaggtgggta
gctgcgacggacggagcacgcagcacggtgcgcgagaagattggcttgaccttcgacggt
ctcacgtggaatgagcggctcgtggcaacgaatgtgttctacgatttcacccttcacggt
tactcccgcgcgaacttcgtgcatgacccgctcgattgggccgtcgtggtgcagctcgac
cagagcggcctatggcgcgtgtgctatggcgaggatccttcgatttcgatggaagaggtt
cgtcgacgcatgccggaacgtttcaagcgacttctgccgggcgcgccgacgcccgaccgt
taccgcgtcgaccacctcaacccgtaccgcgtacaccagcgctgcgctgcggaattccgt
cgcggccgcgtgatcctggccggcgatgcggcgcacgctaccaatcctatgggcggtctg
ggcctgtctggtggtgtgctcgacgcagagcacctgggccgtgcactgatctccgtgatc
aacgagtcggcgccggtgaaggttctcgatgactactcggtggatcgtcggaaggtcttc
ctggagttcacgtcgccgacggcaacacagaacttcaactggatgaaggaaagcgaccct
gcgcaacgcgcccgtgataccgaactgctgacgcacgcgggcacggaccgcgccgtcatg
cgcgagtttcttctgagcttcgagaagcttaatggcagcagccgcccagctccgcccctc
aagcttgcagcgtaa

DBGET integrated database retrieval system