KEGG   Burkholderia sp. YI23: BYI23_F000590Help
Entry
BYI23_F000590     CDS       T01711                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00071  Fatty acid degradation
byi00072  Synthesis and degradation of ketone bodies
byi00280  Valine, leucine and isoleucine degradation
byi00310  Lysine degradation
byi00362  Benzoate degradation
byi00380  Tryptophan metabolism
byi00620  Pyruvate metabolism
byi00630  Glyoxylate and dicarboxylate metabolism
byi00640  Propanoate metabolism
byi00650  Butanoate metabolism
byi00900  Terpenoid backbone biosynthesis
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
byi01130  Biosynthesis of antibiotics
byi01200  Carbon metabolism
byi01212  Fatty acid metabolism
byi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BYI23_F000590
   00630 Glyoxylate and dicarboxylate metabolism
    BYI23_F000590
   00640 Propanoate metabolism
    BYI23_F000590
   00650 Butanoate metabolism
    BYI23_F000590
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BYI23_F000590
   00072 Synthesis and degradation of ketone bodies
    BYI23_F000590
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BYI23_F000590
   00310 Lysine degradation
    BYI23_F000590
   00380 Tryptophan metabolism
    BYI23_F000590
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BYI23_F000590
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BYI23_F000590
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BYI23_F000590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:byi04147]
    BYI23_F000590
Enzymes [BR:byi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BYI23_F000590
Exosome [BR:byi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BYI23_F000590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AET95610
UniProt: G8MQJ5
Position
byi_3p:76319..77485
Genome map
AA seq 388 aa AA seqDB search
MSVAIVGWGHLPFGRLDALSLEDLIVGAGRKALSDADIPADSVDGIWLGNLNGGFVPDIF
AAPLALNCDVGLRWKPAVRLENACASGSAAVYAACDAIEAGRARIALVIGAEKMTSISGS
EVTKILGNCGYSGEAGDFPGGFPGIFARVAQDYFDQYGDHSATLAAIAAKNHANGVANPW
AHMRRDIGFDFCNTVSEKNPLIASPLRKTDCSLVSDGAAALVLVAEEVAADFRKAVSIRA
RVQVNDYLPLAQRRAVDFEGPKRAWSGALREAGCTIDDLSFAEVHDCFTIAELLAYEAMG
LAPSGQGHRLIEDGTVARGGRFPVNASGGLKAKGHPIGATGVSMHVLAAMQLAGQADGMQ
IPGATLGGVFNMGGAAVASYVSILERSR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttgcgatcgtgggttggggtcacctgccatttggccggcttgacgctctgagt
ctggaggatctgatcgtgggcgccggccgcaaagcgcttagtgatgcagatattccagca
gactctgtggatggcatatggctgggtaatctgaatggcggattcgttccagacatattt
gccgcgccgcttgctctgaactgcgatgtcggcctgcggtggaaaccggcggttcgcctc
gaaaacgcatgtgcgtcgggctcggcggcagtctatgcagcatgtgatgcgattgaggcc
ggacgagcacgcatcgccctggttatcggggctgaaaagatgacgtcgatatccggttcc
gaggtgacgaaaattcttggaaattgcggatactcgggtgaggcaggagacttccctggc
ggttttcctggcatcttcgcccgagtcgcccaggattatttcgatcagtacggcgaccac
tccgcgacgcttgcggcaattgccgcgaaaaaccatgcgaacggcgttgccaatccctgg
gcgcatatgcgtcgggatattggctttgatttttgcaacaccgtctcggagaagaaccct
ctgattgcgtctccgttgcgtaaaacggactgctctctcgtctcggacggcgcggccgcg
ttggttctagtcgcggaggaagtcgctgcggatttcaggaaggctgtctcgattcgggcc
cgcgtgcaggtcaatgattatcttcccctggcgcaacgccgagcggttgacttcgagggc
cctaagcgtgcgtggagtggcgcgcttcgagaggccggctgtacgattgacgacctttct
ttcgccgaagtgcatgattgcttcaccatcgcggagctgcttgcctatgaagcgatgggg
ctcgcgccatcggggcaaggtcatcgtttgattgaagatggaaccgtcgcacgcggaggg
cgtttcccggtcaacgcttcgggaggactcaaggcgaagggccatccgatcggagcgacg
ggtgtttcgatgcacgtactcgccgcaatgcaactggcaggccaggctgacgggatgcag
attccgggggccaccctgggaggcgttttcaacatgggcggcgccgcggtggcaagttac
gtcagcattctggagcgcagtcgatga

DBGET integrated database retrieval system