KEGG   Blautia sp. YL58: A4V09_03605
Entry
A4V09_03605       CDS       T04458                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
byl  Blautia sp. YL58
Pathway
byl00230  Purine metabolism
byl01100  Metabolic pathways
byl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:byl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A4V09_03605
Enzymes [BR:byl01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     A4V09_03605
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ANU74924
UniProt: A0A1C7I7L8
Position
798921..801323
AA seq 800 aa
MGVGSSMNRVDAWEKVTGQAKYTADLMPQNLYTAKVVHSTIGNGWVKSFDLEDALKVPGV
IKIVTCFDVPDIQFPTPGHPWSVEKAHQDIKDRKLLNRRVRMYGDDIAAVIAEDEIAARR
AADKIKVEYEEYPVILDPEASMKEGAPLLHEEKPGNVIAHTGFVLGDESFEEAVKEQGLT
IIEKEYRTQPVQHCHIEVPVSYAYMEKGRIVIVTSTQIPHIVRRVVSQALGIPVGQIRVI
KPYIGGGFGNKQDVLYEPLNAFLCTQTGGHGVRLELSREETLGCTRVRHAFTWKIKGAVR
EDGTLVARKYVAYSNQGAYASHAHAIAANAANIFKQLYRDEKVLESDSYTVYTNLMTGGA
MRGYGIPQGDFVTECVADDLAHAVGMDPLAFRLKNCVKEGYIDPHLGIAFHSYGLKACIE
KGKDYIRWEEKRKTYEKQSGPVRRGVGMAIFNYKTGVYPISLETSSCRMVLNQDGSMQLF
MGATEIGQGADTVFTQMAAEVTGITEDRIHIETVQDTDTTPFDTGAYASRQTYVSGKAVK
KTGELFKQRILEYAAFKLKLPKEDGPAAAAEDSGTSGKSTETTAWKMLNIKEDQVIDKAS
GEVLLSLAELAEEALYSLEKSVHITAETTSHCKENSFASGVCFAEVEVDMPLGRIRVLDI
INVHDSGKLINPGLARAQVHGGMSMGMGYALSEELLVDGKTGRPLNANLLDYKIPTAMDT
PGLHMDFVELDDPTGPFGNKALGEPPAIPVAPAIRNAVLHATGIPFDSLPLSPQKLVERF
LKEGLIGGEKGAVKGGGTHV
NT seq 2403 nt   +upstreamnt  +downstreamnt
atgggagttggcagttcaatgaatcgtgtggacgcctgggagaaggtcacgggtcaggcg
aaatacacggcagatttgatgccgcagaatttgtatacggcaaaagtggtgcacagcacc
attgggaacggatgggtaaaaagttttgatctggaggatgctttgaaggtacccggtgtg
ataaagatcgtcacctgttttgatgtgccggatatccagtttcccacaccggggcacccc
tggtccgtggagaaggcgcaccaggatatcaaggacagaaagctgttaaaccgacgggtt
cgcatgtacggggatgatattgcggctgtcatcgcggaggatgagatcgcagccaggcgg
gcagcggataagatcaaagtggagtatgaagaatacccggtgattttggatccggaggca
tccatgaaagagggcgcgcctcttctgcatgaggagaagccgggaaacgtgatcgcacac
accggttttgtgctgggagacgaaagctttgaagaggctgtaaaagagcaaggtctgacc
ataatagaaaaggaatacagaacccagccggttcagcactgccatatagaggtgccggtt
tcctatgcctatatggagaaagggcggatcgttattgtgacctccacccaaatcccccat
attgtgagacgggtggtcagtcaggctcttgggatccccgtcggtcagatccgggtgata
aagccttatataggaggcggtttcggcaacaagcaggatgtgctttacgagcctctgaac
gcatttttatgtacccagacaggcggtcacggcgtcaggctggaactgtccagggaggag
acccttggctgtacccgtgtgcgccatgcatttacctggaagatcaagggtgcagtgcgg
gaagacggcacactggtagcacggaaatatgtggcatattccaaccagggtgcatatgca
tcccatgcccacgccattgcagccaacgcggccaatatttttaaacagctttaccgggat
gagaaggttctggaatctgacagctacacggtctacacaaacctgatgacaggcggagcc
atgcggggatacgggattccgcagggggattttgtgaccgagtgtgtggcggatgatctc
gcccatgcagtgggcatggatcctctggcattccggctgaaaaattgtgtgaaagaggga
tacattgaccctcatctgggcattgcgttccattcttacggactgaaagcctgtattgaa
aagggaaaggactatatccgctgggaggagaaaaggaagacttatgaaaagcagtccggg
cctgtgagaagaggcgtggggatggcgattttcaattataagacaggggtttatcccatc
tcccttgagacttcatcctgccgtatggtcctgaatcaggacggttccatgcagcttttc
atgggggcgacagaaatcggtcagggtgctgatacggtgtttacccagatggcggcagag
gtcaccgggatcacggaggacaggatacatattgagaccgtgcaggatacggataccaca
cctttcgacacgggggcctatgcttccagacagacatatgtgagcggaaaagcggttaaa
aagacaggtgaattgttcaaacagagaatactggaatatgcggcatttaaattgaaactg
ccaaaagaagatgggccggcagccgcagcggaggattctggaacatccggcaaaagtaca
gagactacggcctggaagatgctgaatataaaggaagatcaggtaattgacaaagcttcg
ggggaggtcctgctttcccttgcggaactggcggaagaagcgctttacagcctggaaaaa
tcggtgcatatcacggcggagaccaccagccactgcaaagaaaattcctttgcttcaggc
gtctgttttgcagaggtggaagtggatatgccgcttggcagaatccgggtgctggatatt
atcaatgtgcacgacagcgggaaactgataaatcccggccttgccagagcccaggtacac
ggagggatgagcatgggcatggggtatgccctgagtgaagaactgctggtggacgggaag
acaggaagaccgctgaatgccaacctgctggactataagatacccacagccatggatacc
cccgggctgcatatggattttgtggaattagatgaccctacaggtcctttcggaaacaaa
gccctgggtgaaccgccggctattccggtggctccggctatcaggaatgcagtgcttcat
gccacggggatcccttttgattccctgcctctgtcaccccagaaactggtggaacggttt
ctgaaagaggggctgatcgggggagaaaagggtgctgtgaaagggggcgggacacatgta
tga

DBGET integrated database retrieval system