KEGG   Blautia sp. YL58: A4V09_17270Help
Entry
A4V09_17270       CDS       T04458                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
byl  Blautia sp. YL58
Pathway
byl00260  Glycine, serine and threonine metabolism
byl01100  Metabolic pathways
byl01110  Biosynthesis of secondary metabolites
byl01120  Microbial metabolism in diverse environments
byl01130  Biosynthesis of antibiotics
byl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:byl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A4V09_17270
Enzymes [BR:byl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     A4V09_17270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 B12-binding Pyridoxal_deC Bclx_interact
Motif
Other DBs
NCBI-ProteinID: ANU77340
UniProt: A0A1C7ICC8
Position
complement(3705966..3707006)
Genome map
AA seq 346 aa AA seqDB search
MISFVNDYSENAHPDILNALIETNLEGNVAYSGDEHTERAAKLIRKKIKKEDAEIQILMG
GTQTNLIAACAFLRPHEAIIAVPTGHICIHETGAVESTGHKCIEVKGCAGKVTPQDIEEA
CGPQHWDHAGILCVKPRMVYISQTTEVGTVYTVNELRELRRICDKYNLLLYCDGARLASA
LDCSDVTLLEMAELCDAFYIGGTKNGALFGEALVIINDSLKNEFRYIAKQRGGMLAKGWL
LGLQFEILMSNNLYERIGKHQNEMAKHLKKGLIELGIDFTVDSPSNQLFPILKNSVLDKL
NEEFAYEIISIIDEQRTGIRLVTSWATKKCDVELFLKRLKEEIYHE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgattagttttgtaaatgattacagtgaaaacgcacatccagatatattgaatgccctt
atagaaactaatttagaaggaaatgttgcctattctggggatgagcatacagaaagggca
gctaaacttattcgtaagaagataaaaaaggaagatgcagaaattcagattctgatgggt
gggacacagacaaatttaattgcggcttgtgcttttttaaggccgcacgaagcgattatt
gcagttcctaccggacatatttgtattcatgaaacgggtgcagttgaaagcacaggacat
aaatgtattgaggtaaaaggttgcgccgggaaggttacaccacaagatatagaagaggct
tgtgggccgcagcattgggatcatgctgggattttgtgtgtgaagcctcgtatggtctat
attagtcaaacaacagaggttggcacagtgtatactgtgaatgaattgcgtgaattaaga
cggatatgtgataagtataatcttcttttatattgtgatggggccagacttgcaagtgca
ttggattgttccgatgtgactcttttagaaatggcagaattatgtgatgctttttatatc
ggtggaacaaagaatggtgctttatttggagaggcacttgttataataaatgattctctt
aagaatgagtttagatatattgcaaagcaacgcggaggaatgttggcaaaaggctggctt
ttagggctgcagtttgaaatacttatgagcaataacctttacgagcgaatagggaaacat
caaaatgagatggctaaacatttaaaaaaaggactaatagaattagggattgattttact
gtagatagtccgtctaatcaattgtttccaatactaaaaaatagcgtactagataagtta
aatgaagagtttgcttatgagataatcagtataattgatgagcaaaggactgggattcga
ttggtaacaagctgggccactaaaaagtgcgatgtagaactatttttaaaacgattaaaa
gaagagatttatcatgaataa

DBGET integrated database retrieval system