KEGG   Blautia sp. YL58: A4V09_18155Help
Entry
A4V09_18155       CDS       T04458                                 

Definition
(GenBank) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
byl  Blautia sp. YL58
Pathway
byl00450  Selenocompound metabolism
byl00970  Aminoacyl-tRNA biosynthesis
byl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:byl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A4V09_18155
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A4V09_18155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:byl01007]
    A4V09_18155
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:byl03016]
    A4V09_18155
Enzymes [BR:byl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A4V09_18155
Amino acid related enzymes [BR:byl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A4V09_18155
Transfer RNA biogenesis [BR:byl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A4V09_18155
 Prokaryotic type
   Other AARSs
    A4V09_18155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_bind
Motif
Other DBs
NCBI-ProteinID: ANU77497
UniProt: A0A1C7ICV7
Position
complement(3913924..3914409)
Genome map
AA seq 161 aa AA seqDB search
MTACKLVGKLFPTMKSLGGSDNGKKAEKPVGKAAEKIDFSKVQIEPLFQDMVDFETFARS
DFRAVKVKECSAVPKSKKLLKFILDDGTGVDRVILSGIHDTYEPEELVGKTLIAITNLPP
RPMMGIDSCGMIISAVHHEEGVEKLHCLMVDERIPAGAKLY
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacggcatgtaaattagttgggaaacttttcccgaccatgaagtcactgggtggttct
gacaatgggaaaaaggcagaaaaaccagtgggaaaagctgctgagaagattgatttttct
aaggtgcagattgagccgctgttccaggatatggttgattttgaaacatttgcaagatca
gatttcagggcagtaaaagtaaaggagtgttctgcagtaccaaagagcaagaagctttta
aaattcatcttagatgacggaacaggtgttgaccgtgtgatcttaagcggtattcatgat
acttacgaaccggaagaactggttgggaagacattgatcgcgatcacaaacctgccgccg
cgcccgatgatgggaattgattcctgcggtatgatcatctcagcggtacatcatgaagag
ggtgtggaaaaactgcattgtttaatggtagatgaacgcatcccggcaggagcaaaatta
tattaa

DBGET integrated database retrieval system