KEGG   Bipolaris zeicola: COCCADRAFT_102944Help
Entry
COCCADRAFT_102944 CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
bze  Bipolaris zeicola
Pathway
bze00680  Methane metabolism
bze01100  Metabolic pathways
bze01200  Carbon metabolism
Module
bze_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    COCCADRAFT_102944
Enzymes [BR:bze01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     COCCADRAFT_102944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh
Motif
Other DBs
NCBI-GeneID: 19142665
NCBI-ProteinID: XP_007714910
JGI: 102944
UniProt: W6Y6G9
Position
Unknown
AA seq 714 aa AA seqDB search
MYASQDAPQVNGSTAYGKNAVESLKEEEKLEKSSVGKLSKEHDHVLKTFRLLIADLGAIG
MAAIGVALWKYVMRYAPHTPDYFNRDRFVLSNGHTCLFQYTFLHLTGYKAMTFDQLKSYH
SERVDALCPGHPEIEHEGIEVTTGPLGQGVANAVGLAMATKNLQATYNKPDFDVVSNHTW
CMIGDACLQEGVALEAISFAGHLKLNNLTIIYDNNQVTCDGSVDLTNTEDVNTKMRACGW
HVIDVEDGCFDVEGLVEALNKARSSTDKPTFINVRTIIGVGSAVAGDAVAHGVAFGASDV
ANMKKTYGFNPDEHFVVSDEVRKFFEDIPARGQELVRSWEEKVKEYEAKYPEEGADFRRR
VEGRLVEDWKSWVPEKFPDAPTATRKSSGLVLNPLAEKINNFMVGTADLTPSVNMVWKGK
VDFQHPDLKTTCGINGNYSGRYIHYGVREHAMAAISNGIAAFAPNTFIPVTSSFFMFYLY
AAPAVRMGALQQLQVIHAATHDSIGMGEDGPTHQPIELANLYRAMPNLLYIRPGDSEETA
GAWITAIEAKKTPSIISTSRHTLPQLAKTKRDMVAKGAYVLEEVENADVTLIGVGAELHH
ALDVAKELSAKNTKARVVSFPCQRLFENQPIQYKRETLKRHLGIPAIVIEPFAPNGWERY
ADAACCIKRFGHSLPGKAAYKYFGFDVPALTTKVESYLKQIRDDPLLKGEFVDL
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcatcgcaagatgcaccccaggtgaacggctccacggcatacggaaagaatgcc
gtggaaagcttaaaggaagaagaaaagttagaaaagtcgtcggtggggaagctttcaaaa
gagcatgaccatgtcttgaagacattcagattgcttattgcagacttaggggccattgga
atggcagcaattggtgttgctttgtggaaatatgtcatgcgctatgcacctcacacccca
gattacttcaatcgcgatcgattcgttttatcaaatggtcatacatgtctctttcagtac
acattcctccatctcacaggatacaaagctatgacttttgaccagctcaagtcatatcac
tcggaacgagtcgatgcactatgccccggccatccagaaatcgaacacgaaggcattgaa
gtgacgaccggtccattgggccaaggtgtagcaaacgcagtaggcttagctatggctacg
aaaaaccttcaagccacatacaacaagcccgacttcgatgtcgtatcgaatcacacttgg
tgtatgattggagatgcgtgtcttcaagaaggagtggctttggaagccatttcctttgct
ggtcatttgaagctgaacaatctcaccatcatttacgacaacaaccaagttacttgtgat
ggctcagtcgatctaaccaataccgaggacgtcaacaccaagatgagggcatgtggttgg
catgtaattgatgtcgaagatggctgcttcgacgttgagggtcttgtcgaggccctgaac
aaagcacggtcttccactgacaagcccacttttattaacgttcgaacaatcatcggtgtt
ggcagtgcggtcgctggtgacgccgttgctcatggagtagccttcggtgcatctgacgta
gcgaacatgaagaaaacatacggcttcaatcctgatgaacacttcgtcgtcagtgatgag
gtgcgtaagttctttgaggacattccagccagaggtcaagaactagttcgatcatgggaa
gagaaagttaaggagtatgaggccaaatacccggaagaaggtgcagacttcaggcgtcgg
gtagaaggccgtctggtcgaggattggaagtcttgggtaccagagaaattcccagatgca
ccgacagcgacgagaaagtcatctgggcttgttttgaatccgctcgcagagaagatcaat
aactttatggtcggcactgctgacttgacaccttcggtcaatatggtttggaagggcaag
gtcgacttccagcatcctgacttaaaaacaacatgcggtatcaacggtaactacagtggt
cgttatatccactatggcgttcgtgagcatgcaatggctgcaatctcaaacggtattgca
gcttttgcgccaaataccttcatcccggttacctcttcctttttcatgttctacctttac
gctgcaccggcagtccgcatgggcgctttgcagcaacttcaggtcatacacgcagcgaca
cacgacagtatcggaatgggtgaagatggcccgacacatcaacctatcgaacttgccaat
ctgtatcgagccatgcccaatctactatacatccgacctggtgatagtgaagagacggcg
ggcgcatggatcaccgctatcgaggcgaagaagacgcccagtatcatatcaacgtcgaga
catacactaccacaattggcgaaaacaaagagggatatggtcgcaaagggtgcatacgtc
ctcgaagaggttgaaaatgctgacgtgacactgatcggtgtcggcgccgaactacaccat
gcactcgatgttgccaaagaactgagcgcgaagaataccaaggcgcgcgtggtgagcttc
ccatgccaacggctttttgagaatcaaccgattcagtacaagcgggagacactcaagagg
catctcggaattcctgcaatagtcattgagcctttcgcgcctaacggctgggagcgatat
gctgatgccgcatgctgcataaagagattcggacatagtctccccgggaaggcggcgtac
aagtattttggctttgatgttcctgcgttgacgacaaaggtggagagctacctcaagcaa
attcgcgacgacccgctgctcaagggagaattcgtcgatttgtag

DBGET integrated database retrieval system