KEGG   Bipolaris zeicola: COCCADRAFT_103441Help
Entry
COCCADRAFT_103441 CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
bze  Bipolaris zeicola
Pathway
bze00260  Glycine, serine and threonine metabolism
bze00630  Glyoxylate and dicarboxylate metabolism
bze00670  One carbon pool by folate
bze01100  Metabolic pathways
bze01110  Biosynthesis of secondary metabolites
bze01130  Biosynthesis of antibiotics
bze01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    COCCADRAFT_103441
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COCCADRAFT_103441
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    COCCADRAFT_103441
Enzymes [BR:bze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     COCCADRAFT_103441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C DUF3659
Motif
Other DBs
NCBI-GeneID: 19142770
NCBI-ProteinID: XP_007715056
JGI: 103441
UniProt: W6Y5Z5
Position
Unknown
AA seq 457 aa AA seqDB search
MASRKAVVALRPVANALAPQVGRLQCPKAARYSTRSCTLPAPRPRNFTGPARKHVRWASS
QAADEQLGKTGLYELHSKYGAKFVPFGGYLMPVQYSDLSIIDSHNWTREKASLFDVGHMV
QHHFSGPGAEAFLESITPSALSALPKHQSTLSTLLNSNGGIVDDTVITRLTDRFYVVTNA
GCREKDTAYFKAQLDSWKSKHSGQPVEWQILDGQGLVALQGPLSSEILSRVLDDKSKKDL
ESLYFGQCANATIKGTDAEVLVSRGGYTGEDGFEISIPAYATEAVTQYLLDSAKDELRFA
GLGARDTLRLEAGMCLYGHDLDDTTTPVEAGLSWIIGKDRRAKGGFLGDSVILQQLKKKS
EGGGVSRRRVGLVVEGSPAREGAEIVNEAGEKIGNITSGCPSPTLKKNIAMGYIQDGMHK
AGTEVDVVVRGKKRKAVVTKMPFVPSKYFKQPANVKA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcctccagaaaagcagtcgttgcgttgcgcccggtagccaatgcccttgcgccccag
gttggaagacttcaatgcccaaaagccgcccggtattcaaccagatcatgcacactgcca
gccccgcgaccccgcaacttcacaggaccagcgcgaaagcatgtgcgatgggcttcttca
caagcagcagacgaacagctgggcaagactggcttatatgagttacacagcaagtatggc
gccaagtttgtgccctttggcggatacttgatgcctgtccaatacagcgacttgagcatc
atcgactcgcacaattggacgcgcgaaaaagccagtttgtttgatgtcggccacatggtc
cagcaccacttttctggtcccggtgccgaggccttcctcgagagcatcactccctctgcc
ctctctgccctgcccaagcatcagtctaccctctcaaccctgctcaactccaatggtggc
attgttgacgacactgtcatcacgcgcctcactgacaggttttatgttgtgacaaatgca
ggctgtcgagaaaaggacactgcatacttcaaggcacagctggactcatggaagagcaag
cattctggtcaaccagtcgaatggcagattctagacggacaaggccttgtcgccctccag
ggacccctctcctccgagatcctctcccgtgtgcttgacgacaagtcaaagaaggacctt
gaatcactctactttggccagtgtgccaatgcgaccatcaagggtaccgatgccgaggtg
cttgttagccgtggtggctatactggcgaagatggctttgagatcagtattcctgcttat
gccaccgaagccgtcactcaatacttgcttgactcggccaaagacgagctgcgatttgca
ggtctcggagcacgcgacacccttagactagaagccggcatgtgtctttatggccatgac
ctagacgacaccacaacacctgtcgaggccggcctttcctggatcatcggcaaagaccgc
cgcgcaaaaggcggcttcctcggcgactctgtcattctgcaacaactaaagaaaaagtcg
gaaggcggaggtgtttcacgccgtcgagtaggtctcgtcgttgagggatcccccgcccga
gaaggcgctgagattgtcaatgaggctggtgagaagattggcaacatcacctctggctgc
ccatcacctaccctcaagaaaaacattgccatgggttacatacaagacggcatgcacaag
gcgggcactgaagtcgatgttgtggttcgtggtaagaagcgaaaggctgtcgtcacaaag
atgccattcgtaccaagcaaatatttcaaacagccagccaacgtaaaggcatag

DBGET integrated database retrieval system