KEGG   Bipolaris zeicola: COCCADRAFT_103948Help
Entry
COCCADRAFT_103948 CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
bze  Bipolaris zeicola
Pathway
bze00350  Tyrosine metabolism
bze00360  Phenylalanine metabolism
bze00380  Tryptophan metabolism
bze01100  Metabolic pathways
bze01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    COCCADRAFT_103948
   00360 Phenylalanine metabolism
    COCCADRAFT_103948
   00380 Tryptophan metabolism
    COCCADRAFT_103948
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    COCCADRAFT_103948
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bze04147]
    COCCADRAFT_103948
Enzymes [BR:bze01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     COCCADRAFT_103948
    4.1.1.105  L-tryptophan decarboxylase
     COCCADRAFT_103948
Exosome [BR:bze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCCADRAFT_103948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 19142878
NCBI-ProteinID: XP_007715273
JGI: 103948
UniProt: W6XYR9
Position
Unknown
AA seq 520 aa AA seqDB search
MDSSQFRKAAKGAIDEIAQYYDTLEERPVLPAVKPGYLRPLLPSSTPEEGEPWEAIQADI
DRVIMPGLTHWQSPKFMAFFPCNSSFEGMLGEMYSGAFNAAAFNWVCSPAITELETVVMD
WVAKLIALPSDFLSDGEGGGIIQGTASEVVLTALVAARERIIRRKLGDMPEGEERLDAAA
DIRSKLVALGSEHAHSSTQKAAIIAGTRFRTVPAPKESNYSVTAAALRGTIEACRAKGLE
PFYFTITLGSTGTCAIDDLAGIAQLAKEYPDLWIHVDAAYAGSALVCPEYQHLCPPIASF
DSFNFNLHKWLLVNFDCSAFFIKKRKDLMDTYSITPSYLRNPHSDQGLVTDYRDWQIPLG
RRFRSLKVWFVLRSYGVSGLRAFIRKHIELGVYFQSLLDGRKDLFKVETEAAFGLVTFQI
KPKVETGAQDGSAANRPDPRHGALQNAFQGDAEAQYAEMVNQRTKEVYERVNSKGDFFLT
SSVIGGRYLIRVVSATTKSEEKWMMMLFEELVEIAEEKTA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggattcctcacagttccgaaaggcggcgaaaggagccattgacgaaattgcacaatac
tatgacacattagaggaacgaccagtcctgcccgctgtcaaaccaggctatctccgccct
ctcctcccatcctcaaccccagaggaaggcgagccatgggaagccatccaagcagacatc
gaccgcgtaatcatgccgggtctcacgcactggcaatcacccaaattcatggcattcttc
ccctgcaattcctccttcgaaggcatgctcggtgaaatgtacagcggagcctttaacgcc
gcagccttcaactgggtctgctcgcctgccatcaccgagctcgaaaccgtcgtcatggac
tgggtcgccaagctcatcgctctacccagtgacttcctcagcgacggcgaaggcggcggc
atcatccaaggcaccgcgagcgaagtcgtcctcaccgcgctcgtcgccgcccgcgaacgc
attatccgccgcaagctcggcgacatgcccgagggcgaagaaagactcgatgccgcagca
gatatccgcagcaaactcgtagccctcggttccgaacacgcgcattcttcaacccaaaaa
gcagcaatcattgcaggaacccggttccgcaccgttcccgcaccgaaagaatcaaattac
agtgtcaccgccgccgcactccgcggcacaatcgaagcctgccgcgcaaaaggcctcgag
ccgttttacttcactatcaccctcggcagcacgggtacctgcgccatcgatgatcttgcc
ggcatcgcgcagctcgcgaaagagtaccccgacctctggattcacgtcgacgctgcatac
gccggttccgcgctcgtctgtcccgaataccagcatctatgccccccaattgcatcgttt
gactcgttcaatttcaatctgcacaagtggcttctcgtgaactttgactgctctgctttc
tttattaagaagcggaaagatctcatggatacctattccattaccccgagttacctgcgg
aatccgcactcagatcagggtctcgtgactgattaccgcgactggcagattccgctgggt
cgccggtttcgtagcttgaaagtgtggtttgtgctccggagctacggagtctcgggtctg
agggcgtttatacgcaagcatattgagttgggtgtgtatttccagagtttgctggacgga
cggaaagatcttttcaaggtggagactgaggcggcgtttgggctcgtgacttttcagatt
aagccaaaggtggagactggtgcgcaagatgggagtgcggcgaatcgcccggatccgagg
catggggcgctgcagaatgcgttccagggtgatgctgaggcgcagtatgctgagatggtt
aatcagcggacaaaggaggtgtatgagagggtgaatagtaagggggatttctttttgact
agttcggtgattggggggagatatctcattcgggttgttagtgcgacgactaagagtgag
gagaagtggatgatgatgctttttgaggagttggtggagattgctgaggagaagacggca
tga

DBGET integrated database retrieval system