KEGG   Bipolaris zeicola: COCCADRAFT_108287Help
Entry
COCCADRAFT_108287 CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bze  Bipolaris zeicola
Pathway
bze00130  Ubiquinone and other terpenoid-quinone biosynthesis
bze01100  Metabolic pathways
bze01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    COCCADRAFT_108287
Enzymes [BR:bze01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     COCCADRAFT_108287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 19143708
NCBI-ProteinID: XP_007716945
JGI: 108287
UniProt: W6XT01
Position
Unknown
AA seq 242 aa AA seqDB search
MLCPRPYSVSRQLTSAFQIHNRINTRAVTQHHHAFSTATPYQSHKPTQPCRPKRIVIGIT
GATGTIYAVRLLEILRDLSIETHLIMSKWAHTTLKYETDRTEAEIHSLASRVYTARDMTA
PIASGSFLHDGMIIVPCSMKTLAAVRIGFCDDLISRAADVTLKERRTLMLVPRETPLSDI
HLENLLAVRRMGAVVFPPMPAFYTRPKSLEDMVEQSVGRMLDNFGIHTDGFERWNGCDWK
NK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgctctgccctcgaccttacagcgtcagtcgccaattgacgagtgcattccaaattcac
aaccgcatcaacactcgcgcagtcactcaacaccaccacgccttctcaactgcaactcct
taccaatcccacaaacccacacaaccatgccgcccaaaacgcattgtaatcggcataacc
ggcgcaacaggcaccatctacgccgtccgcctcctcgaaatcctacgtgacctatccata
gaaacacacctgataatgagcaaatgggcccatacaactctcaaatacgagaccgatagg
acggaagccgaaatccattccctcgcctccagagtctacacggcacgcgacatgacggct
ccaattgccagtggatccttcctgcacgacggcatgatcatagtgccctgtagcatgaag
acgctcgccgctgtgcgcataggcttttgcgacgatctgatctcgcgcgccgctgatgtg
acgttgaaggagcgccggacgctgatgctggtgccgcgcgagacgccgctgagcgatatc
cacctggagaacctgttggcggtaaggaggatgggggccgtggttttcccgcccatgcct
gcgttttatacgcggccgaagagcctggaggatatggtggagcagagtgttgggcgcatg
ttggataatttcggcattcatactgatgggtttgagaggtggaatggttgtgattggaag
aataaatga

DBGET integrated database retrieval system