KEGG   Bipolaris zeicola: COCCADRAFT_30722Help
Entry
COCCADRAFT_30722  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bze  Bipolaris zeicola
Pathway
bze00260  Glycine, serine and threonine metabolism
bze01100  Metabolic pathways
bze01110  Biosynthesis of secondary metabolites
bze01130  Biosynthesis of antibiotics
bze01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COCCADRAFT_30722
Enzymes [BR:bze01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     COCCADRAFT_30722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Hpt Cys_Met_Meta_PP GlgX_C
Motif
Other DBs
NCBI-GeneID: 19146805
NCBI-ProteinID: XP_007717784
JGI: 30722
UniProt: W6XRG6
Position
Unknown
AA seq 344 aa AA seqDB search
MLCAIARTTLNDDVYMEDETTINFEQEVADLCDHEAAAFVVSGTMANQLALRTLLWQPPH
AILADASAHIVHWEAGGISHFSGAMLQTVRPSNNLYLTLEDIQKSAVLSYDVHKCPTRVV
SIENTSNGSVVPLEELRRVKDWATRAGIQVHIDGARLWEAIAAGGGTLSEYAQCADLLTV
DFSKGIGAPMGAMVIGSAESIQRLRRIRKSIGGGMRQSGVLVAAARQALLENFGMSQTDI
RGILKKSHSLAGTIGMLWTEKGGKLVRPVETNIVWLNLRASGVTDSEWNQAGHKHGIKLM
GNRVVTHYQISDQALSALTSVILSVLTNQKQGGTREKDCRTVKL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgctttgtgctatcgctcgcaccactttgaacgatgacgtttacatggaagacgaaaca
acaataaacttcgagcaagaagtggctgatctctgcgaccacgaagccgccgcatttgtt
gtctccggtacgatggcgaaccagctagctttacgaacactgctctggcaacctccacat
gctatccttgccgatgcaagtgcgcatatagttcactgggaagctggtggaatttcccac
ttttcgggagccatgctgcaaactgtgcggccaagcaacaatctttatttgactctagaa
gatatccaaaagagtgccgtcctgtcgtatgacgtacacaagtgcccaacaagagttgtg
agcattgaaaatacttcaaacggaagcgtggtaccactagaagaattacgtagggtcaaa
gattgggctacaagagccgggatacaggttcatatcgatggtgcaaggctttgggaagcc
attgcagctgggggtggtacactctcagaatacgctcagtgtgctgatttgctgactgtc
gacttcagcaagggtattggtgcaccaatgggtgcgatggtcatcggttcagcagagtcg
atccagcggttgcgccggattcgcaaaagtataggcggtggtatgcgtcagtctggagtt
ttagttgcagctgcaagacaagcacttcttgagaattttgggatgagccagactgatata
agaggaattttgaagaaaagtcattcgttggcaggtaccattgggatgctatggactgaa
aaagggggaaagctagtcagacccgtggaaacaaatattgtatggctaaatctgagggcc
tcaggtgttactgatagtgaatggaaccaagctgggcataagcatgggatcaagttgatg
ggtaaccgagtcgttacgcattaccagataagcgatcaggctctttccgcactgacatct
gtcatcctgagcgttctcacaaaccagaaacaggggggtactagagaaaaggactgtcga
actgtaaagttgtga

DBGET integrated database retrieval system