KEGG   Bipolaris zeicola: COCCADRAFT_3922Help
Entry
COCCADRAFT_3922   CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K02365  separase [EC:3.4.22.49]
Organism
bze  Bipolaris zeicola
Pathway
bze04111  Cell cycle - yeast
bze04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:bze00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    COCCADRAFT_3922
   04113 Meiosis - yeast
    COCCADRAFT_3922
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bze01002]
    COCCADRAFT_3922
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bze03036]
    COCCADRAFT_3922
Enzymes [BR:bze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     COCCADRAFT_3922
Peptidases and inhibitors [BR:bze01002]
 Cysteine peptidases
  Family C50: separase family
   COCCADRAFT_3922
Chromosome and associated proteins [BR:bze03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    COCCADRAFT_3922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 19148947
NCBI-ProteinID: XP_007710936
JGI: 3922
UniProt: W6YT91
Position
Unknown
AA seq 2187 aa AA seqDB search
MASKNEAHARISNIKTDLQSISTCSNATVSALQEILSKKEDEPPQKENVKGKTQTTARRR
AAAGAAADAQKQKTYTIAPREKYILATEVANKTLQTLAEALKNPAPVIAARLPSKSKPAP
TEDARKPARPGQAKTPPLSQQPLRERSASQVHNSPHKRAPRRSSSYSSFLSPGPDPGLVA
TAECARTAFAFLGTPEATKVLGKDSRELQYENGVLALIGKLVAHGLDNMAVKELRTLKRR
LDRYIGRDTAQQNGAIDKESLASLLDFAVIDPSSPVIPLAASFQSYTLRIIAKLKRPRTI
EATWEFLKPTNPSSPANLLLSTAKSPASQAKVARQLESLAQTILSLCPSISSADDANTLQ
PSAEKVLLLQHLAFSVRKQWWGLVKHQSNEEQELSEPFAKCLIAFGRRSQLIPIKKYKLA
ETLYTDLLGWSDGATTSPNGAPASATASKTLSSLAQAAGLSDQALRWLGSSTSSTTSKTP
AVKQTARTIRIATITIEAYVKGEKKNDLNDVITNALDALNGSLGGSAADLESLFAEVNAL
RRAATKILIARLSKPSDDDEKLAVAQQAVSVIAASIHFSARFVGTTYPHEADSKTQGQHH
ERVTLAWKYMKGAIDSVMACCKQTIKTEDEWKDYDILLQECSHVLRRFEEETKDGTVSAE
ETESIIGSYFVKLSNGYWALYMQLRRARCKPDTLVMPMRRSIDLVQSRDPTEQESGLLSM
KLEQLGETLEDLGQVESSRDAFRQCIQSHLTADILQQLSETAAKSSLSTTFSDTGPFSVI
ARLLKGYHHSFLKFGIRQTDEIAYFDIGTIHADVEGALLELQLHFNLRTLSKNRKWDSTL
DKSIRSLIERLRIVYAQETYPVRRLRSSIAVLQLLQSDPQILSQDNQTSGFDWDENVGTE
QSQDQALKGYQAHLKALYDLKSSMQQSSPPTSTLQQCFATWESLVTSASSWDTLSDRIDD
IDVWLKDLHACAEYLNAKGEEYLALPLLHLLVNILELQKSADGSELLTTLCALGLQLLRL
GYTGKAGLCLAKAEALIKSRTCSIDARLEWHVAYAEYLLGVGNPAKCSAIMENAQSIALG
DSKFLDLAKPTTTLSGRLRFNRIVADASYVHSLFATAAGSYKEAARHARQCITLNRRIWA
ALESRSNAKKAASADELESEADGPSKTAFDPLSSLRIDKGVPVVMSVTHGALSGPDFWAL
VPSMYRALMQQSQIFAHQGLLHEAIYVAEQAEKVASATQSATLMTDNASWRADCWAQSNR
PDKAEAILKSLDAPTSRKCLSTAGYYSAVARTHHWNGQYEQEIESYNLMEQLLKDLSSPV
YMKTLESFSPPVDALTDQLSSLTVDTKVTKAKPATRGRKPAAKAAPRTTAKSATGTRPRA
ATTRAGKTAPKLTRQPSAPPASEESTTTDQCAGLCVFQASMRDRAVLANILHDDLTEALK
LLGQAEDLQNGLNQEVSHMWATFKARLAQSAKQIAEDFTVNTLPESTIAFPAFGLKDCRL
SEVEPVKKGTLVSSAISKAGRAKKQPKEDFMDTLREARDRLVEAHALCATNGSNHLFRQT
SMALGHVTVLMSAVAGSDLPGSLHPMYAAYMSELPKVNALRLVQESTEAEKEQLSRDECM
QWPVTDASSFSFASVSEFQKDYVDIIPETWNAVSLALSEARDELFITRFEKGLSPFVLRL
PLARHASRDMDEDEFSFDDGKRDFDEIIELSDFSTRSAKDMTSREARQQWWAEREALDTR
LHELLINMENIWLGGFKGVFSQHERQPVLLAEFRKSLENILNDHLPSRKKKSQQKRPVLD
ARVLELFIGLGDATNEELDLDEALMDLIYFVVDILQFNGERNAYDELDFDAMVVETYEAL
RAYHSASHKLEAACRHTILILDKDLHGFPWESLPCLEQLSISRLPSLAALRERLLSARPC
GSKAETAPAGHYICSNMRGTSMLNPSGDLAHTSKTIAPRLDQLQGSWDRISNRAPSEKEF
ESSLREKDLVLYFGHGSGAQYVKSKAVRRLYAGQGDEEGRKAGCATTLLFGCSSVHLSEN
GIFEPSGMLASYLTAGAPAVVGMLWDVTDKDCDRFAVKAGELWGLWPESQDDSGGPVKSV
GKTPAKKAKGKGRAGQLIDEVEGVRSGESAKKGKKIARAADGDGGIEGERPRGVGLDEAV
REARKACVLRYLNGAAAVVYGIPVYLE
NT seq 6564 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaaagaatgaagcgcacgcgcgtatcagcaacatcaaaaccgacctccaatca
atctcgacatgttccaacgccacagtcagcgcgctccaggaaattctctcgaaaaaggaa
gacgagccaccacagaaagaaaatgtaaagggcaagacacagacgactgcgcggaggaga
gcagcggcgggtgcggctgccgatgcccagaaacaaaagacatacacaattgcgcccagg
gagaaatacatactggctaccgaagtcgcaaacaagaccctccaaacacttgctgaagca
ctcaagaacccagcaccagtaatcgccgcccgtctcccttccaagtcgaagccagcaccc
accgaagatgctcgcaagccagcgcgacccggccaagcaaagaccccgccactctcacaa
cagcctctccgcgaacgatccgcctctcaggtacacaattcgccccacaaacgcgccccg
cgccggtcgtcgtcatattcgtcgttcctgtccccaggccctgatccaggcctggtcgcc
acggccgagtgcgcaaggacggcattcgcattcctgggtaccccagaagcaacaaaggtc
ctggggaaagattctagggagttgcagtacgaaaatggcgtgcttgcgctcattgggaag
ctcgttgcacacggtctagataacatggccgtcaaagagttaaggaccttgaaaaggagg
ttggatagatacattggccgtgatactgcacaacaaaatggcgctatcgacaaggaaagc
ttggcttcacttttggactttgcagtcatagaccccagtagccctgttataccactggcc
gccagcttccaatcatacacattgcgtatcatcgccaaactaaaacgaccacgaacaatt
gaagccacctgggaattcctgaaacccaccaacccgtcctcacctgcgaatctacttttg
agcactgcaaagtctccagccagccaagctaaagtggctaggcagcttgagtcgttagcc
cagactattctctcactatgcccgagtatttcgagcgcggacgacgcaaacactctgcaa
ccatctgcagagaaagttttgcttctgcaacatctggccttcagtgtgagaaagcagtgg
tggggcctcgtcaaacaccagagtaatgaggaacaagagctgtcagagcccttcgccaag
tgtttgatcgcctttggccggagatcccaacttattcctatcaagaagtacaagctggcc
gagactttgtacacagaccttttaggatggtctgatggtgccactacttcaccaaatggt
gctcctgcatcggccaccgcgagcaagactttgtcctcacttgcccaggctgcgggattg
tctgaccaggctcttcgatggctaggctcttcaacttcctccaccacgtccaaaactccc
gccgtgaagcaaacagcgaggacgatacgaatagctaccatcactatagaggcttacgtc
aagggcgaaaagaaaaatgatctgaacgacgtaattacgaatgccctcgatgccttgaat
ggaagcctgggtgggtcagcggcggatctcgagtcgctctttgcagaagtcaatgccctg
agacgagcagcaacgaagatccttattgcacgtctgtctaagccttcagacgacgacgaa
aagctggccgtagcgcagcaggctgtatcagtcatcgctgcaagtattcatttctcagca
aggtttgtgggtacaacatacccacatgaagccgactcaaaaacacaaggtcagcaccac
gaacgggtaactttggcctggaaatacatgaagggtgccattgactcggtcatggcatgc
tgcaaacagaccatcaagactgaggacgagtggaaagattacgacatattgttacaagaa
tgctcacacgtacttcgtcgtttcgaggaagagaccaaggatggaactgtctcagccgag
gaaaccgaatctatcattggatcatattttgtcaaattatccaacggttactgggctctc
tatatgcagctacggagggcccgctgcaaacccgataccttggtcatgcctatgcggcgc
tccattgaccttgtacaatcaagagacccaactgagcaagagagcggacttctctcgatg
aagcttgagcaactaggtgagaccttggaagatctcggccaagttgaaagctcccgcgac
gcttttcgacaatgtatacaaagtcacctcactgcagatatcctgcaacagctttccgaa
actgcagcaaagtcatctctttccacaacattcagcgataccggtccatttagtgtaatt
gccaggcttctgaaaggttaccatcattcgttcttaaagtttgggattcgccagacggat
gaaatcgcatattttgacattggcacaattcatgcagacgtcgaaggagctttattggag
ttgcagttgcactttaacttacgaactttgtcgaaaaatcggaaatgggactcgacccta
gacaaatcaattcgcagtttgatcgaacgactccgtatagtgtacgcccaggaaacctac
ccggttcgacgactgaggtcgtctatcgccgttcttcagcttctacaaagcgatccgcaa
atcttgtcacaagacaaccaaacttctggctttgattgggacgagaacgtaggaacagag
cagtctcaagaccaagcattgaagggatatcaagctcatctaaaagcactttacgatctc
aaatcctcgatgcagcaatcatctcctcctacgtcaactcttcagcaatgctttgccacg
tgggagtctctcgtcacctctgcatcttcctgggatacactgagtgatcgaattgacgac
atagatgtttggctaaaagatcttcatgcatgtgcagaatatctcaatgcaaagggcgaa
gaatacctcgcattgccgcttctccatcttttagtgaacattcttgaacttcaaaaaagt
gccgacggatccgagctcctcaccacactgtgcgctttggggctacagctgctgcgtctt
ggttacactgggaaagcaggcctctgccttgctaaagctgaagcactgatcaaatcccgg
acctgttctatcgatgccagactggagtggcacgtggcatatgcagaatatctgctgggt
gtagggaatccggcgaaatgttcggcgataatggaaaatgcccaatctattgcacttgga
gactccaagtttttggacttggcgaagccgacaaccacactctccggccggttgcggttc
aacagaatagtggcagatgcttcctatgttcattcgttgtttgctactgctgctggatca
tacaaagaagcggctcggcatgcgaggcagtgtatcacactgaatcggcgtatttgggct
gccctcgaatcgcggtcaaacgccaagaaggctgcatctgcagacgaacttgagtccgaa
gcagatgggccgagcaaaacagcgtttgacccgttgagttctctccgtattgacaagggg
gtacctgttgtcatgtctgtcacccacggcgcccttagcggacctgacttctgggctttg
gtcccatccatgtaccgggctctaatgcagcaatcgcaaatctttgctcaccaagggttg
ctgcatgaggccatttatgtcgctgaacaagctgagaaggttgcttctgcaacacaatct
gcgacactcatgactgacaatgccagctggcgtgctgactgttgggcccagagcaacaga
cccgataaagctgaggctattctgaaatcgctggatgcgcctacttcacgcaaatgctta
tcgactgccggctactattctgctgttgccagaacacatcactggaatggtcagtatgag
caggagatagagtcatacaatctcatggagcagcttctgaaagatttgagttcgcctgta
tacatgaagactctagagtctttttcccctccggttgatgcgcttacagatcagttgtcg
tccttgacagtggataccaaggtaaccaaagcaaaaccggcaacaagaggccgtaagcct
gcggccaaagccgcaccacggacaaccgcaaagtctgccaccggtacccggcctagagca
gctacaacccgagctggaaagacggcaccgaaactaacccgccaacctagtgctccacca
gcgtcagaggaatcgaccactaccgaccagtgtgccggattgtgtgtcttccaagcaagc
atgagggatcgagctgtacttgcgaatatcctacacgacgatctcactgaagctctgaag
cttcttggtcaagcggaagacctgcagaacgggttgaaccaggaagtatcgcacatgtgg
gctactttcaaagcgaggcttgcacagagcgcaaagcagattgcggaagacttcactgtc
aacacacttccagagtcgacaattgcgttccctgcctttggtctcaaagactgcaggctt
tccgaggtagagcctgtcaagaaagggactcttgtgtcttctgctattagcaaagctggc
cgagcaaagaagcaaccaaaagaggactttatggacacactccgcgaagcacgagacaga
cttgtagaagcgcatgctctgtgtgccaccaatggctcgaaccatttattccgccagact
tctatggcgctgggtcatgttacggtgctcatgtcagctgtggcgggtagcgacctgcca
ggctctctacacccgatgtatgcggcatacatgagtgaactacccaaggtcaacgcattg
aggcttgtgcaggagtcgactgaggcggaaaaagagcaattatcccgcgacgagtgcatg
caatggccggtgacagatgcatcaagtttttcatttgcgtcagtatcggagtttcaaaaa
gattacgttgacatcatcccggagacgtggaatgcggtatcgttggctcttagtgaagcc
cgcgatgagctcttcattactcgtttcgagaagggtctgtcgccatttgtgttgcgcctg
ccattggctcgccacgcctctcgcgacatggacgaggacgagttctcgtttgacgacgga
aagagagactttgacgagattatcgagctcagcgactttagcacgcgaagcgccaaggat
atgacttcgagggaggcaagacaacagtggtgggctgaacgtgaggctctcgacacgcgg
ctacacgagctactcatcaacatggagaacatctggcttggcggcttcaagggtgtcttt
tcacagcacgagagacaaccagttctgcttgcagagttccgcaagtcactggagaacatc
ctgaacgatcacctgccgtctcggaaaaagaagagtcaacaaaagcgaccggtactggat
gcacgagttctggagctgtttattgggcttggggacgccaccaacgaggaactcgacttg
gatgaagcgctgatggatctgatttactttgttgttgacatcctccagttcaacggtgag
cgcaatgcatatgacgaactcgattttgatgccatggtggtcgagacgtatgaagctctc
cgggcgtaccatagtgcatcacacaagctggaagctgcttgccgtcacacgatactcatt
ttggataaggacttgcacgggttcccatgggagtcgctgccatgcctagagcagctatca
atctctagactaccctcgcttgcggcccttcgcgaaaggctgctctcggcacgaccgtgc
ggatccaaagcggagactgcgccggctggccattacatttgctccaatatgagggggacg
agcatgctcaacccatcaggggacctggcacacacatctaagacgatcgcgccgcgtcta
gaccaactccagggatcatgggatcgcattagcaatcgggcgccatcagaaaaggagttt
gaaagcagtctgcgagaaaaggatctagtgctgtactttggtcacggcagcggtgcacaa
tatgtcaagtccaaggcagtacgacgactgtatgcaggccaaggagacgaggagggcagg
aaagcaggatgtgcgacgacgctactgtttggctgctcttccgtccaccttagtgaaaac
ggcatatttgaaccgtcggggatgctcgcttcttatcttactgccggcgcaccggctgtt
gtgggcatgctttgggatgtcacggacaaggactgcgatcgctttgccgtcaaggctggc
gagctatggggactgtggcccgagtcgcaagacgacagtggtggtccggtgaagagtgtg
ggcaagacgcctgcaaagaaggctaaaggcaaaggtagagctgggcaattgatagacgag
gtggagggagtgcgaagtggggaaagcgcaaagaagggcaaaaagattgccagggcagca
gatggcgatggtgggattgagggcgagagaccgaggggagtcgggctggacgaagccgtc
cgggaagcacgcaaggcctgtgtgctgcgatatctcaacggggcggctgcggtggtgtat
ggcatccctgtgtatctagagtag

DBGET integrated database retrieval system