KEGG   Bipolaris zeicola: COCCADRAFT_39813Help
Entry
COCCADRAFT_39813  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
bze  Bipolaris zeicola
Brite
KEGG Orthology (KO) [BR:bze00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bze03041]
    COCCADRAFT_39813
   03110 Chaperones and folding catalysts [BR:bze03110]
    COCCADRAFT_39813
Enzymes [BR:bze01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     COCCADRAFT_39813
Spliceosome [BR:bze03041]
 Complex C
  Other components
   PPlases
    COCCADRAFT_39813
Chaperones and folding catalysts [BR:bze03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    COCCADRAFT_39813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase PHD_3
Motif
Other DBs
NCBI-GeneID: 19149098
NCBI-ProteinID: XP_007715817
JGI: 39813
UniProt: W6XVV7
Position
Unknown
AA seq 495 aa AA seqDB search
MSSTYNLEPNPTAKVVLHTTAGDLELELFAKQTPVTSRNFLQLCLDGYYDNTVFHRLVKG
FIIQGGDPTGTGQGGQSSYDGEPFADEFHSRLKYTRRGLLGMANTGTKDDNGSQFFFTLA
PTPELQDKNTLFGRVAGDTIYNLMKMAEAEIRDGSDDQPMYPTKVTGADIIVNPFEDMVR
RVQAAVPTEAETKKPKKPKRKAGKNVLSFGDDEDTAGSAPVAKKPKFNTKLVSAGDEKAP
SSKPTEPAKAMPIRNSSRNSPSPPPEPKPAQKQAPKSPPAPKPRSPPRELSPEAEKRAKL
DRVNQQIAELKASMKRGTQIQDAAPVKKKSLLEAMVPSTTTRGRKRGAGGNSKDEQSSLD
ILARFKSKLEAAEPATMPKPAASTLSENTPNENESGHGNSGDQDDEAACDLHFIVGCQSC
KAWDAQEDEGSDDDAGWMSHSLSFAKDRLGKDLEWKRKNEEELLVIDPREEAKRLKAQGK
GKREWDDSKANKAKR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgacatacaacctcgagcccaatcccacggccaaggtggtgctgcacaccacc
gccggcgacctggagctggagctgttcgccaagcagacgcccgtcacgtcgcgcaacttc
ctgcagctgtgtctcgatggctactacgacaacaccgtcttccaccgcctggtcaagggc
ttcatcattcagggcggcgaccccacgggcaccggccagggcggccagagcagctacgat
ggcgagccttttgcagacgagttccacagccgcctcaagtacacgcgccgcgggctgctg
ggcatggccaacacaggcaccaaggacgacaatggcagccagttcttcttcacccttgcc
ccgacacccgagctgcaggacaagaacacgctatttggccgagtggccggcgacaccatt
tacaacctcatgaagatggccgaggctgagatccgcgacggaagcgacgaccagcccatg
tacccaacaaaagtcacgggcgcagacattattgtaaacccctttgaagacatggtccgt
cgggtgcaggctgctgtgcccacagaggcagagactaagaagcccaagaagcccaagagg
aaagccggcaagaatgtcctgagttttggagacgacgaggatactgctggttctgcgccc
gttgcgaagaagcccaagttcaacaccaagctagtcagtgcaggcgatgagaaagcacca
tcctccaaaccaacagagccagcaaaagccatgcccatacgcaactcatctcgcaactct
ccctcaccgcctcccgaacccaagcctgcacagaaacaagcccccaagtcaccgcctgcg
cctaaaccccgctcgcccccacgagaattgtcgccagaggccgagaaacgagcaaaactt
gatcgtgtgaaccagcaaattgccgaactcaaagcctcgatgaagcggggcacgcaaatt
caggatgcagcgcctgtcaagaaaaagtctctgctcgaagccatggtaccctcaacaacc
acgcgcggacgcaagcgcggtgctggtggaaactcaaaagatgagcaatcctcgttagac
atcttggcacgcttcaaatccaaactcgaggctgcagagccagccacaatgcccaaacca
gccgcttcaacactgtccgaaaacacgccaaacgaaaatgaaagcggacatggtaacagt
ggtgatcaagacgacgaagccgcatgtgacctgcatttcatagtaggctgtcagtcgtgc
aaagcctgggacgctcaagaagacgagggttccgatgacgatgcaggctggatgtcccat
tcgcttagttttgcaaaagacaggctaggcaaagaccttgaatggaagcggaagaacgaa
gaagagctactggttatagatccaagggaggaagcaaagagactcaaagcccagggtaag
ggcaagagagaatgggatgattccaaagcaaacaaggcgaagcgatga

DBGET integrated database retrieval system