KEGG   Bipolaris zeicola: COCCADRAFT_40800Help
Entry
COCCADRAFT_40800  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bze  Bipolaris zeicola
Pathway
bze00010  Glycolysis / Gluconeogenesis
bze00071  Fatty acid degradation
bze00350  Tyrosine metabolism
bze01100  Metabolic pathways
bze01110  Biosynthesis of secondary metabolites
bze01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCCADRAFT_40800
  09103 Lipid metabolism
   00071 Fatty acid degradation
    COCCADRAFT_40800
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    COCCADRAFT_40800
Enzymes [BR:bze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     COCCADRAFT_40800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N DUF1188 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 19149343
NCBI-ProteinID: XP_007716971
JGI: 40800
UniProt: W6XSW7
Position
Unknown
AA seq 274 aa AA seqDB search
MKAFRFETVDQGLCLQQVPPPSPSPGEVVVRVEAAGICHSDLHVLHGQGSGWMSKLPITL
GHEVAGIVEEVGPDVVGFKIGDRVGVALLPKDADLTNVIGIAAITGSTTVAIVGLGGLGL
SGVGIASIEGATVLGVDIDDKKFADATAFGAKACFKKLDDIPSEVIIDVVVDFAGVGTTT
QDALRRFRSSGMVVLVGFGVPTFELSTNTLMSRNLTLRGLVGSTMAEYRKVLDLIASGLI
KPKLEEIPFLEIPNGLRRLERLEVVGRLFSRPNA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttccgatttgaaaccgtcgatcaaggcctatgcttgcaacaagtgccccct
ccgagtccctcacccggagaggtggtagtccgtgttgaggccgccggtatctgtcactct
gatttgcatgtactacacggtcagggaagtggctggatgtctaagttgccaatcacactc
ggacatgaggttgcgggtatagtggaagaggttggaccggatgtggtcgggttcaagatc
ggtgatcgagttggggtggctcttcttcctaaagatgccgatttgacaaatgtcattggt
attgcggctataactggatctacaacggtggcgattgtcggactcggagggctaggactg
agtggggtcggcatagcttcaatcgaaggcgctacagtattgggtgtggatatcgatgac
aaaaagtttgctgatgctactgcctttggcgcaaaagcatgcttcaagaaactcgacgat
atcccttctgaagtcatcatagatgttgtagtcgactttgctggggttggaacaacaact
caggatgctttgcgaagattccgatcatctgggatggtagtattagttggattcggggtg
ccaaccttcgaattatctaccaataccttgatgtcgcgcaatctcacccttcgtggattg
gtagggtctacaatggctgaatatcgcaaggtactagatttgattgcttctgggctaatc
aagcccaagttggaggagattccttttcttgaaatacctaacggtcttcggaggcttgag
cgccttgaggtagttggtcgacttttttcaagaccaaacgcataa

DBGET integrated database retrieval system