KEGG   Bipolaris zeicola: COCCADRAFT_42294Help
Entry
COCCADRAFT_42294  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bze  Bipolaris zeicola
Brite
KEGG Orthology (KO) [BR:bze00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    COCCADRAFT_42294
Enzymes [BR:bze01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     COCCADRAFT_42294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 19149684
NCBI-ProteinID: XP_007719013
JGI: 42294
UniProt: W6XI11
Position
Unknown
AA seq 269 aa AA seqDB search
MVRIAIAQIRSTDSAEANLHISEDLIQQASSEGAQAIFFPEASDYICSDGARCKQLCQPI
EYSIFVQGLRKQARKYKLPVAVGIHEPCTDAENTRVKNTLVWINEAGEVLHRYQKVHMLE
MKLSDGPQIHEGDFCQPGRSVLSPFETPIGRVGAMICFDLRFPSLAQKLVSMGAEILIYP
SAFVPNTGELHWIPLLQARAIECQAYVIAPDQVGQHNEQRSSYGHSVVIDPWGRIIAQLG
SEENVLAYAEIDREQVKHARQSLFLRKRE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggttcgaattgccatagctcaaattcgctctaccgattccgcggaagcaaatttgcac
ataagtgaagaccttattcaacaggcttctagtgaaggcgcccaggctatcttttttcct
gaagcttccgactacatatgctccgacggggcaagatgcaagcagctttgccagcctata
gagtattcaatctttgttcaaggtttgcgaaaacaagcgagaaaatacaagctgcctgtc
gcagttggcatccacgagccttgcactgatgccgaaaacacacgcgtaaagaatacgttg
gtatggataaatgaggctggtgaagtcctgcatcggtatcaaaaggtgcacatgcttgag
atgaaactctcagacggccctcagattcatgaaggcgacttttgtcagccaggaagatcc
gtactttcacccttcgagacccccatagggcgagtaggtgcaatgatttgttttgattta
cgttttccgtccctagcacagaaactcgtcagcatgggagctgagatactcatctaccct
tcagcatttgtacctaataccggggagcttcactggatcccacttctgcaagcaagggcg
attgagtgtcaagcatatgtcatagctccagatcaggtcggacagcataacgaacaaagg
tcgagctacggtcatagtgttgttattgacccttggggtcgtatcattgctcagctaggg
agcgaggagaacgttcttgcgtatgccgaaattgatcgcgagcaagtcaagcatgcacgg
cagagcttgttcttgagaaaaagggagtaa

DBGET integrated database retrieval system