KEGG   Bipolaris zeicola: COCCADRAFT_6545
Entry
COCCADRAFT_6545   CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
bze  Bipolaris zeicola
Pathway
bze00910  Nitrogen metabolism
bze01100  Metabolic pathways
Module
bze_M00531  Assimilatory nitrate reduction, nitrate => ammonia
bze_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    COCCADRAFT_6545
Enzymes [BR:bze01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     COCCADRAFT_6545
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Rieske Pyr_redox Rieske_2 Fer2_BFD NIR_SIR_ferr Rubredoxin_C GIDA K_oxygenase
Other DBs
NCBI-GeneID: 19150463
NCBI-ProteinID: XP_007714115
JGI: 6545
UniProt: W6Y1R2
Position
Unknown
AA seq 1157 aa
MAETEPIVTQGIEPLSGESHSPPGERHITATWGSKDGNVSNREWNDAEANKLPEKVAELE
KKGEINNDRPRKRIVVVGLGMVGIAFIEKLMKYDVKRREYDVVVIGEEPHLAYNRVGLTS
FFQHRQVENLYLNPQEWYSSMPEGALSYHLNTLVTEINSEEKTVKTSFGETVSYDILVLA
TGSDALLPRHTPGHDAQGVFVYRTIEDLQRLIEFSSSRKGTTGAVVGGGLLGLEAAHAMM
DLEDFAKVKLIERNRWVLSRQLDGDAGGMVVEQVRALGLDVMLSKRVGKILATEDNFVKG
VVFEDGEEMECSCICFAIGIKARDELARKAGIKCADRGGGIVVGHDLATSQRDIYAIGEC
ASWENQTFGLIAPGVEMADVLAFNLTQAKAHAPRKFKAPDLSTKLKLLGVEVASFGDFFA
DRDGPKNLPGRQRADSKEPNAKTTRDKVKNLTDGPAPPPVKALTYKDPFQQVYKKYLFTM
DGKYLLGGMMIGDTKDYIKLVPMVKNQKPLEIPPSELIVGAQKGEDDGSDLSDDTQICSC
HNVTKGDVVNATKDGTCKSIGDVKSCTKAGTGCGGCMPLVQTIFNKTMASMGNEIKNHLC
PHFEYSRADLFNIIYVKGLKDFASVMKEAGKDANSLGCEACKPTIGSIISSLYNRHLLEV
NNRGLQDTNDRFLANIQRNGTFSVVPRVSGGEITPEKLIIIGTVAKKYNLYTKITGGQRI
DMFGARKQDLPDIWQELVDGGMESGHAYAKSLRTVKSCVGTTWCRFGIGDSVGMAVRLEE
RYKSIRGPHKFKGGVSGCVRECAEAQNKDFGLIATEKGFNIFVGGNGGAKPRHSELLAKD
VPPDDVVPILDRYLAFYIRTADKLQRTARWMENLPGGIKYLQEVILQDKLGICADLEKQM
EDLVGTFFCEWTEVLKDPKKRAWFSQFANTSETIVDTIEPTQERGQERPSYWPKDSITED
FRGTKWTELSWQPLVKASEFQDADTGDSKAIKRGDTQLAVFKVRGKYYCTQQMCPHKRAF
VLSDGLIGDDLANNKLWVSCPYHKRNYELSGENAGKCTNDESVNIAVFPIEERDDGWLYV
KLPSVEELDSVLGTSKFKIKKSETEDPFVALDKKLQRLQLKGRKGVPVSHLEGGLGEKGK
ASQILAGGERGAGGLDW
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcggaaacggaaccgattgtcacacaaggcatcgagcctttgtcgggtgaatcgcac
tcgccaccgggtgaacgccacatcacagcgacctggggatcaaaagatggaaacgtatca
aatcgagaatggaatgatgcggaagcaaacaaactgcctgagaaggtagcggagctggag
aagaagggagagattaataatgatcgcccacggaaaagaatcgtggttgtagggttgggc
atggtcggcattgcttttattgaaaaactcatgaagtacgatgtcaagcggagagagtac
gacgtcgtcgtcattggcgaagagccgcatcttgcatacaatcgagttggcctaactagc
ttcttccaacatcgccaagtagaaaacttgtacctcaatccgcaagaatggtattcctcc
atgcccgaaggcgcattgagctaccacctcaacacccttgtcaccgagattaattccgag
gagaagacagtcaaaacatcatttggagagacagtatcatacgacatcctagttctggca
acgggttcagatgcgcttcttccccgacacacgcctggtcacgatgcacaaggtgtattc
gtgtaccgaactatcgaggatttgcaaagattaatagaattttcctcttcacgaaagggt
acgactggcgcagtcgtgggtggcggtctgcttggtctcgaagccgcacatgcgatgatg
gatctagaagactttgccaaagtcaaactgattgagaggaaccgatgggtgctgtcaagg
caattagatggcgatgccggcggtatggttgtagagcaagtaagagcattaggtctggac
gtcatgctaagcaagagggtgggcaagatcctggccaccgaggacaactttgtcaagggc
gtggtatttgaggacggtgaagagatggaatgttcttgcatttgctttgcgattggcatt
aaagcccgagatgagctagccaggaaagccggcatcaaatgtgctgacagaggaggcggc
atagtcgttggacacgacctggcaacatctcaacgcgacatctatgccattggcgagtgt
gcgagctgggaaaaccaaacctttggcctcatcgcccctggtgtcgagatggccgacgta
ctagctttcaacttgacccaagcgaaagcacacgcaccgcgaaagttcaaagctccagat
ctcagcacaaaactcaagctgctaggtgtcgaagttgcaagtttcggtgacttcttcgcc
gatcgcgatggacctaagaacttacctggacgccagcgcgccgatagcaaggagccgaat
gcgaagacgacgcgagacaaggtcaagaatctgacagatgggccagcaccaccaccagtc
aaggcgctcacatacaaggatccgttccagcaggtctacaagaagtacctgtttaccatg
gatggaaagtatttgctgggtggcatgatgattggtgatacgaaagactacatcaagctt
gtgcccatggtgaaaaaccagaaaccgctcgaaataccgcccagcgagctcattgtcggc
gcacaaaagggtgaagacgatggttctgatctatccgatgatacccagatctgctcatgc
cacaacgtcaccaaaggcgatgtagttaatgctactaaagacggaacctgcaagagcatc
ggcgatgtcaagtcttgcaccaaagccggcactggctgcggtggctgcatgccgctcgtc
caaaccattttcaacaagaccatggcgtccatgggcaacgagatcaagaaccatctctgc
ccacactttgagtactctcgcgccgacctcttcaacatcatctacgtcaagggtctcaaa
gattttgcttctgtgatgaaagaagcaggaaaggacgccaactccctgggatgcgaggcc
tgcaaaccgaccattggaagcatcatctcttcgctgtacaacaggcatctccttgaggta
aataatcggggtcttcaggatactaacgatcgattccttgcaaacatccagcgcaacggc
acattttccgtcgttccccgagtttctggaggcgagatcacaccggagaagctcatcatc
atcggaacagtggcgaaaaaatacaacctctacaccaagattacgggtggccagcgcatc
gacatgtttggtgcacgcaaacaagacctcccagacatttggcaagagctcgttgatggc
ggcatggagtctggtcatgcgtacgcaaagtcactacgcactgtcaaatcatgcgttgga
actacatggtgccgcttcggcattggcgatagtgtaggcatggctgtgcgtctcgaagag
cgctacaagtccattcgtggtccacacaaattcaaaggcggagtttcgggctgtgtccgc
gaatgcgcagaggctcaaaacaaggactttggtctcattgccaccgaaaaaggattcaat
atctttgtcggtggcaacggtggtgcaaagcccaggcattcagaactattggccaaagac
gtaccaccagatgacgtggtccctatcctcgatcgctatctcgcattctacatccggacg
gccgacaagctgcaacgaacagcgcgatggatggagaatctccccggcggtatcaagtac
ctccaggaagtcatcctgcaagacaaactcggcatctgcgccgatctcgagaagcaaatg
gaagatctcgtcggtaccttcttctgcgaatggaccgaagttctcaaagaccccaagaaa
cgcgcctggttctcgcaattcgcaaacacctcggaaaccatcgtcgacaccatcgagccc
acacaagaacgcggccaagaacgtccttcctactggcccaaagactccatcaccgaagac
ttccgcggcacaaaatggacagagctctcctggcaacccttggtcaaagcctcagagttc
caggacgcagatacaggtgacagtaaggcaatcaagcgcggcgacacgcaactcgccgtc
ttcaaagtccgcggcaaatactactgcacgcagcaaatgtgcccgcacaagcgcgccttt
gtgctctccgacggcctcatcggcgatgacctcgcaaacaacaaactctgggtctcgtgc
ccctaccataaacgcaactacgagctctctggcgaaaatgcaggcaagtgtacaaacgac
gagtctgttaatattgctgttttcccgatcgaggagcgtgatgatggttggttgtatgtt
aagctgcccagtgtggaggagctggatagcgtgctagggacgagcaagtttaagattaag
aagagtgagacggaggatccgtttgtggcgcttgataagaagttgcaaaggttgcagctt
aaggggaggaagggcgtgccggtgtcgcatcttgaggggggattgggggagaaggggaaa
gcctcgcagatactggctggcggtgagaggggtgctgggggattggattggtga

DBGET integrated database retrieval system