KEGG   Bipolaris zeicola: COCCADRAFT_8Help
Entry
COCCADRAFT_8      CDS       T03110                                 

Definition
(RefSeq) glycoside hydrolase family 32 protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bze  Bipolaris zeicola
Pathway
bze00052  Galactose metabolism
bze00500  Starch and sucrose metabolism
bze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    COCCADRAFT_8
   00500 Starch and sucrose metabolism
    COCCADRAFT_8
Enzymes [BR:bze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     COCCADRAFT_8
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975 BNR
Motif
Other DBs
NCBI-GeneID: 19150966
NCBI-ProteinID: XP_007706260
JGI: 8
UniProt: W6YUU3
Position
Unknown
AA seq 637 aa AA seqDB search
MFRSSPLLSLALGTLSAVGAQELPAVLTADIIQGLGNNTLFTRWRPTYHFSGPAGWLNDP
CGMMYDPTTKTYHLHYQWHPNHVNWGNISWGHATSKDMITWTDVGGWENDQAQSLGTGPN
PDSRNSSYYGLGIFSGSGQPYNLHGEQDGTLINFYTSVQHLPTNWAIPYIPGTEKQSIAI
SKDGGETWEQYAGNPILSHPPEGWNITGWRDPFVEPWPEMDALLGHEEPHWYMAMGSGIK
GENGGGRIPFYSAPANNLTDWTFLGALWEPKRNETLGSLLETGTYGFNFEVSNFFSLNDE
DDDVHYYVLMGTEGGNLTWHPRAQWGLWNEGQVNKRENGSVEFTPVAGGAIDSGLLYAVT
SFVDSKNDRRIQWGWANEENNNFAITQTGYQGAMAIPREMYVIKTSHLVNNDSQLTTKGN
TRVVEHGNGTFTGYTLGARPLPEIIEALHNGSEPQVIDGKDGCASGDVSGNGTSHMHLQV
TLSDFTGPAGVVIAQSPNHEEQTVVWYSPENYTINVDRSHSSTIVEFANYTMLGYFYPYT
FANGTTESLHMDIFVDGSLVEIHVNDRFWLTTRIYPARTDSTGFGIWAEEGSTVKAKDLK
VWDIDFNVFPERPENSSSKLIYDTPEETNNYVWWTGN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgctcttcccctcttctgagccttgcactcggcaccctgtctgctgtcggtgca
caggagttgcccgctgtgctgactgcagacattatccaaggtttgggtaataacaccctc
ttcaccagatggcgcccgacctaccatttcagtgggcccgctggatggctaaatgaccca
tgcggtatgatgtacgatcctacgacaaagacgtaccatttgcattaccaatggcacccc
aaccacgtgaactggggcaatatctcttggggccatgccacctccaaggatatgatcacg
tggactgatgttggaggttgggaaaatgaccaagctcagtctctcggcactggacccaac
cctgactcccgaaactcgagctactacggtttgggcatcttttccggcagtggccaaccg
tacaacctccatggtgagcaggacggtacgctcatcaacttctacacttcggtgcagcat
ttgcctaccaactgggctatcccttatatcccaggaaccgagaaacagagcattgccatt
tccaaggatggtggtgagacttgggagcagtatgctggaaaccccatcttgtcccacccg
ccagagggctggaacattactggatggcgtgatcccttcgttgagccttggccagaaatg
gatgctctccttggacacgaggagccacactggtacatggccatgggctccggcatcaag
ggagagaatggcggtggccgcattcccttctacagcgcccctgcaaacaacctgactgac
tggactttcttgggtgctctctgggagccaaagagaaacgaaactcttggttctctgctc
gagactggaacatacggcttcaactttgaggtatcaaactttttctctctgaacgacgag
gatgatgatgttcactactacgtactcatgggtactgagggtggaaaccttacctggcat
ccacgtgcgcaatggggtctctggaacgagggacaagtcaacaagcgtgaaaatggctcg
gtcgaattcactccagttgctggtggtgcgatcgactccggactgctctacgctgtaacc
agctttgtggactcgaagaacgaccgacgcatccaatggggctgggctaacgaggagaac
aacaactttgccattactcagacaggataccaaggcgctatggccattcctcgggaaatg
tacgtcatcaagaccagccacctggtcaacaacgactcgcagttgactaccaagggcaac
actcgtgttgtcgagcacggtaacggtacttttacgggatacactcttggtgcccgccct
ctgcccgagattatcgaagctctccacaatggctcggagcctcaagtcattgacggcaag
gatggttgcgctagtggagacgtctccggcaacggtaccagccacatgcatctccaggtt
accctttccgacttcaccggccctgctggtgtcgtgattgcgcagtcgcccaatcacgag
gagcagaccgttgtgtggtacagccctgagaactataccatcaacgtcgaccgttcgcac
tcatctacgattgtcgagtttgccaactacaccatgctcggctacttctacccgtacact
ttcgccaacggtaccaccgagtctctgcacatggacatctttgttgatggctccctggtc
gagatccacgtgaacgaccgcttctggctcacgacccgtatctaccctgcccgcactgac
agcactggattcggcatctgggccgaggagggctccaccgtcaaggccaaggacctcaag
gtctgggatatcgacttcaacgtcttccctgagaggccagagaactcgagcagcaagctc
atctatgacaccccagaggaaaccaacaactatgtttggtggactggaaactaa

DBGET integrated database retrieval system