KEGG   Bipolaris zeicola: COCCADRAFT_8266Help
Entry
COCCADRAFT_8266   CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
bze  Bipolaris zeicola
Brite
KEGG Orthology (KO) [BR:bze00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bze01002]
    COCCADRAFT_8266
Enzymes [BR:bze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     COCCADRAFT_8266
Peptidases and inhibitors [BR:bze01002]
 Metallo peptidases
  Family M16: pitrilysin family
   COCCADRAFT_8266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 19151414
NCBI-ProteinID: XP_007716148
JGI: 8266
UniProt: W6Y369
Position
Unknown
AA seq 1097 aa AA seqDB search
MAGALEREAVRQRIEDLERPQLDDRSYRIVTLPNQLEVLLIHEAETDKASAALDVNVGSF
SDAPDMPGIAHAVEHLLFMGTEKYPEENAYNQYLTRHGGYSNAFTASTSTNYYFELSYAA
TSPTASKAVTPEASSTNLLESADESPLRGALDRFGQFFISPLFLEDTVDRELKAVDSENK
KNLQNDTWRMHQLNKALANPNHPYNHFSTGSYKTLHDEPIARGVKIRDEFIKFHSTHYSA
NRMKLVVLGKESLDTLESWVEEIFSKVPNKNLGQNRWDVPVYTETELLTQTFARPVLQSR
SLDLQFAYRDEENFYESHPSRYLSHLLGHEGPGSVLAHLKAKGWANGLGAGGSTLCPGSG
LFTVNIKLTEDGLKNYKDVVKTVFQYIGLMRDQPPQEWVVEELMRISEVEFRFKQKSPPS
RTASGLAGIMQKPYDRKMLLSGPAVIRKFDANLINEAMSYLRPDNFRLTIISQDFPGGWD
QKEKWYGTEYKIERIPGDFLAEIKEAFESKSRPAELHFPHKNEFIPTRLDVEKKEVAQPS
KEPKLIRHDDNVRIWWKKDDQFWVPKANVHIYFRTPMTNVTARVTLLCTLYRELVNDALV
EYAYDADIAGLVYDFTNHISGLSITVSGYNDKLHVLLEKVLLQVRDLEVTEDRFNIIHDR
MLRSLRNWEYGQPFHQVGTYSRQFKSEKCVMNDELLPELDNITAKDVQQFFPQILAQCQI
EVLAHGNLYKEEALRITDLVERTIQPKRLPANQIPTRRGLLWPSGCNFIYEKQLSDPANV
NHCIEYNLYVGHHYDNVTRAKLLLLGQMTDEPCFNQLRTIEQLGYVVFSGSSFHDVWSGY
RILIQSEKDCRYLEGRIENFLNTFEGTLAAMSEEDFESHKRAMINKRLAKLKNLSSEDNR
FWNHIYSDSYDFLQADVDAENLEKLSKKGMIEFYGRYVSTSSSQRSKLSVHLQAQAKAKE
PSIEEKKTSAAASLQIILTEHKLKFDDAAFQTRVADASSIDDISKAVTRYLSEDIKVEGD
VATKVLDEAKAALGVAESGLPAAPQTLDAAADVESVVDASHPVLIKDVHAWKASMQISTG
VRPVRNLDEFVDVVEKL
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atggctggagcgttggaacgggaggctgttcgacagagaatcgaggatctcgagaggccg
cagctcgacgaccgctcctatcgaatcgtcactctaccaaaccaattggaagtccttttg
atacacgaggcggagaccgacaaggccagtgcggcgctggatgtcaatgtgggcagcttc
agcgatgcgcccgatatgccaggcattgcccatgctgtagagcatctgctgttcatgggc
accgagaagtatccagaagagaatgcgtacaatcagtacctgacgcgccacggtggctat
tcaaacgccttcaccgcctcaacatcgacaaactattatttcgaactctcctacgctgcc
acatcgcccacggccagtaaggctgtgacaccagaagcatcatcgacaaacctgttggag
tcggcagatgagtcaccgctacgaggcgcattggatcgcttcggccaattcttcattagt
ccgctgtttctcgaagacacggtggatcgcgagctcaaggcagtggattcagagaataag
aaaaacctccaaaatgacacttggcgcatgcaccagctcaacaaggcgctcgccaatccc
aatcacccctacaaccacttctccacaggtagttacaaaaccctacatgacgaacccata
gcacgtggcgtcaagattcgtgatgagtttatcaagttccactcgacgcactactccgcc
aacaggatgaagttggtagtcttgggtaaggagagtctggacacattggaatcatgggta
gaagaaatcttttcaaaggtgccaaacaaaaatctcggacagaaccgctgggatgtacct
gtctacacagagacagagcttttgacgcaaacctttgctcggccagttctccagtctcgg
tcgttggaccttcagtttgcctaccgcgacgaagagaacttttacgagtcgcatccatca
agataccttagtcatttgctcggtcatgaaggccctggtagcgttcttgcgcacctcaaa
gcgaagggttgggcaaatggactcggcgcaggaggctcgactctgtgtccagggtcaggg
ctgttcactgtaaacatcaagttaacagaggatggcctgaagaactataaagacgtcgtc
aaaactgtcttccaatatattggtctgatgcgcgatcagccaccccaagagtgggtagta
gaagaactgatgcgcatcagtgaggtagagttccgcttcaagcaaaagagcccaccaagc
cggactgccagcgggctggcaggtatcatgcagaagccatatgaccgcaagatgttactc
agtgggccagccgttatcaggaagttcgacgccaatctgatcaatgaagccatgtcatat
ctgcgaccagacaacttcaggttgaccatcattagccaagatttcccaggtggttgggat
caaaaggagaaatggtatgggacggagtacaaaattgagagaataccaggagatttcctt
gcagagatcaaggaggcttttgaaagtaagagccgaccagcagagttgcacttcccccac
aagaatgagtttataccaactcgattggatgttgaaaagaaggaggtcgcacagccaagc
aaggaaccaaagcttattcgccacgatgacaatgtccgcatatggtggaagaaggacgat
cagttttgggtgcccaaagccaacgttcacatctacttccgaacaccaatgaccaacgtt
accgcacgcgttacacttttgtgcacgctctatcgcgagcttgtgaacgatgctctggtc
gagtatgcttatgacgctgatattgcggggctggtgtatgatttcaccaaccacatcagt
ggtttgtcgataacagttagcggctacaatgacaagttgcacgtgctactggagaaggtg
ttgctccaggttcgggatctggaagtcacggaggatcgtttcaatatcatccatgatcgc
atgctacggtctctacgcaactgggagtacggacagcctttccaccaggttggcacttac
tccagacagttcaagagcgaaaagtgtgtgatgaacgacgagctacttccagaactggac
aacatcacagctaaagatgtgcagcagttcttcccgcagatccttgcccagtgccagatc
gaggtgcttgcgcatggcaacttgtacaaggaagaagctttgagaatcaccgaccttgta
gaaaggactatccagcccaagcggctgcctgcgaaccagatccccacccgccgaggtctg
ctttggccttcggggtgcaatttcatctacgaaaagcaattgagcgacccggcaaacgtc
aaccactgcattgagtacaacttgtacgttggacatcactatgacaacgtcacccgtgcc
aaactattgcttcttggacagatgacagatgagccttgcttcaatcaacttcgtaccatt
gaacagcttggttatgtcgtcttttctgggtccagcttccacgacgtctggtctggatac
cgcattttgattcagagtgagaaggactgtcgatacttggagggccgcattgaaaacttc
ctcaatactttcgagggaacgcttgctgcaatgagcgaagaagactttgagagccacaag
cgagccatgatcaacaagcgcttggcgaagctcaagaatctttcatcagaagacaacagg
ttctggaatcatatctacagtgactcgtatgatttcctacaagccgacgttgacgctgag
aaccttgaaaagctctcaaagaagggcatgattgaattctatggccgatatgtctcgacg
tcatcttcacagcgttccaagctgtcagtgcacctccaagcacaagccaaggccaaggag
ccatcgatcgaggaaaagaagacttctgctgctgcttcgcttcagatcattctcaccgaa
cacaaactcaagtttgatgatgcggctttccagactcgcgtggccgatgcatcgtccatt
gacgatatctcaaaggctgtgactcgttatctgagcgaagacatcaaggtggagggtgat
gttgcaaccaaggtgctagatgaagcaaaggctgccctcggtgtcgccgaatctggcttg
ccagcagcaccacaaacactagatgcggctgcggatgtagagagtgtggttgatgcgtcg
catcctgtgctcatcaaggatgtgcatgcgtggaaggcgagcatgcagatcagtaccggc
gtacggccagtgcggaatctggatgaattcgttgatgttgtagagaagctctga

DBGET integrated database retrieval system