KEGG   Bipolaris zeicola: COCCADRAFT_84379Help
Entry
COCCADRAFT_84379  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
bze  Bipolaris zeicola
Pathway
bze00020  Citrate cycle (TCA cycle)
bze00640  Propanoate metabolism
bze01100  Metabolic pathways
bze01110  Biosynthesis of secondary metabolites
bze01130  Biosynthesis of antibiotics
bze01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCCADRAFT_84379
   00640 Propanoate metabolism
    COCCADRAFT_84379
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bze04147]
    COCCADRAFT_84379
Enzymes [BR:bze01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     COCCADRAFT_84379
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     COCCADRAFT_84379
Exosome [BR:bze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCCADRAFT_84379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A VID27_N
Motif
Other DBs
NCBI-GeneID: 19151756
NCBI-ProteinID: XP_007707888
JGI: 84379
UniProt: W6YJR9
Position
Unknown
AA seq 443 aa AA seqDB search
MYNLARARPLARAVRAAAETPLKRSVIQQRRGLAIHEYRSAALLESYGIGVPKGGVATSG
AEAEKIAQEIGGEDAVIKAQVLAGGRGKGTFDNGFKGGVRVVYSPREAAILAEQMIGHKL
ITKQTGAAGRLCNSVFIVDRKFARREFYLAILMDRASQGPVIVASSQGGMDIETVAKEHP
EAIITTPIDIHKGVTDEMARNIATELGFSEQCIEDAKDTIQKLYKVFMEKDATQIEINPL
SETTDHQVLAMDAKLNFDDNADFRQKEVFDWRDITQEDPDEVKAAKVGLNFIKLDGDIGC
LVNGAGLAMATMDIIKLNGGAPANFLDVGGGATPEAIRQAFELITSDPKVTAIFVNIFGG
IVRCDAIAKGLIQVVQEMNLKTPVIARLQGTNMEAAQKLINDSGLKIFSIDDLQGAAEKS
VQFSKVVKMARDIDVGVEFTLGI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccttgcccgcgcccggccgctggctcgcgctgttcgcgctgctgctgaaaca
ccactgaagcgctccgtcatccagcaaaggagaggccttgccatccacgaatacaggtcc
gcggccctgctcgagtcgtatggcattggtgtgcccaagggcggcgtcgctaccagcggc
gcagaggctgagaagattgcccaggaaattggcggagaggacgccgtcatcaaggcccag
gttcttgccggaggccgtggcaagggaacctttgacaacggcttcaagggcggtgtcagg
gttgtctactctccccgcgaagcagccatccttgccgagcagatgatcggccacaagctt
atcaccaagcaaactggagccgccggccggctctgcaactccgtattcattgtcgaccgc
aagtttgcccgccgtgagttctacctcgccatcctcatggaccgcgcttcccaaggcccc
gtcattgtcgcttcgtcgcaaggtggaatggacattgagaccgtcgcaaaggagcacccc
gaggccatcatcaccacccccattgacattcacaagggcgtcaccgacgaaatggcgcgc
aacattgcgaccgagcttggtttctcggagcagtgcatcgaggatgccaaggacactatc
cagaagctctacaaggttttcatggagaaggacgctacccagatcgagatcaaccccctc
tctgagactaccgaccaccaggtcctcgccatggatgccaagctcaactttgacgacaac
gccgacttccgtcagaaggaggtctttgactggagggacattacccaggaagaccccgac
gaggtcaaggccgccaaggttggtcttaacttcatcaagctcgacggtgatattggctgc
ctcgttaacggtgccggtctggccatggctaccatggacattatcaagctcaacggcggt
gcgcccgctaacttcttggatgtcggtggcggtgctacccccgaggccatcaggcaagct
ttcgaactcatcaccagcgaccccaaggtcactgccattttcgtcaacatctttggtggt
atcgtccgctgtgacgccattgccaagggtctcatccaggttgtccaggaaatgaacctc
aagactcctgttattgctaggttgcagggtaccaacatggaggctgcgcagaagctgatc
aacgactctggtcttaagattttctccatcgatgatctccagggtgctgctgagaagtcg
gttcagttctcaaaggttgtcaagatggcacgtgatattgacgttggtgttgagttcact
ctgggtatctaa

DBGET integrated database retrieval system