KEGG   Bipolaris zeicola: COCCADRAFT_94419Help
Entry
COCCADRAFT_94419  CDS       T03110                                 

Definition
(RefSeq) glycoside hydrolase family 32 protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bze  Bipolaris zeicola
Pathway
bze00052  Galactose metabolism
bze00500  Starch and sucrose metabolism
bze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    COCCADRAFT_94419
   00500 Starch and sucrose metabolism
    COCCADRAFT_94419
Enzymes [BR:bze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     COCCADRAFT_94419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 19153751
NCBI-ProteinID: XP_007711660
JGI: 94419
UniProt: W6YEY7
Position
Unknown
AA seq 620 aa AA seqDB search
MLVTAPPTTPFTFKKVPGVSVFSTPLVSEATPEPSERWRPRLHLVAPRGWLNDPCAPGYD
PVNKKYHLGFQWNPNSTEWGNISWGAAVSHDLLTWKVSDRPSMQPSAQCDSGGVFTGCLI
PTAIDGSESGVLTAAYTSVSRLPIHYTRPYFRTSEAIALATSTDSGRTWIRHAKNPVLAE
PPPGIDVTGWRDPFVAPWPSMDKLVDQHRVNRDTRSLYAVVAGGIRGKTPTAFLYQVDAN
ALDAWQYLGPLITPGLNFCPSPRWTGDFGVNWEVSNFVSLASADGKACRNFLICGVEGRL
ATDDMIRTKGNFRATNAQMWLCGSLETAPGVHMKFRFGGRLDHGLYYAGNSFWDPQTQQQ
VIYGWIREDDLDAELRQRQGWTGIISLARVLKMQALTGVTGALSSPLQSIGSIELVPEDT
HGSSFTAITLCAVPDPRLCKLRGCRFPSKETPEQSPGGIFVFPVAWRQWEMELEFRPEEG
AAKLGFDIVHSAAEFTRVYFDVNAETIVIDRSCSTSLDGIRTCQEEAPHTLFTIRQRGKD
SPFTEKGILETLKFHVLYDSSVLQVFVNERTALTTRVYPAGGTSTGIRPLVERTCYHSSN
TGGPKSRAWNMALWPLSLSV
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgctagtaaccgcacccccgactactcctttcacgttcaaaaaggtgcccggagtgagt
gtattctctacccctctggtctccgaagcgacacctgaaccgagtgaacgatggcgacca
cgcctacatctcgtggctcctcgtggttggctcaacgacccttgcgcccctggatacgac
ccggtcaataaaaagtatcatctgggtttccagtggaatccaaacagcacagaatggggc
aacatttcctggggtgcagcagtatcccacgatcttctcacatggaaagtctcagatcgc
ccatctatgcagccctctgcacagtgcgattcgggcggtgtgttcaccggctgtctgata
cccactgcaatcgatggttcagagagcggcgtcctgacagcagcgtatacatcagtgtct
cgtctcccaattcactacacgcggccatatttccgaacatcagaggcaatcgctttggct
acatcaaccgactctggcaggacatggattagacatgcgaagaaccctgtcctcgcagag
cccccgccgggcatcgacgtgaccggctggcgagatccgttcgtagctccctggccgagc
atggataaactcgttgatcagcatcgagtgaaccgagacaccagatcattgtatgctgtc
gtagccggaggaattcgagggaagacaccgacagcctttctctaccaagtggacgcaaat
gcgctggatgcatggcaatatcttggccctttgattacccctggcctgaacttttgccct
tcgcctcgctggacaggagattttggcgtgaactgggaggtgagtaattttgtatccctg
gcaagtgcagatggcaaggcatgccgcaactttctcatttgtggcgtcgaaggtcggtta
gctaccgacgacatgattcgcaccaaaggcaacttccgggcgaccaatgcgcaaatgtgg
ctttgcggcagcctcgagactgcgccgggtgtgcatatgaagttccgtttcggaggcaga
ttggaccatggcctgtactatgctggcaactcgttctgggatccgcaaacacagcagcag
gtcatatacggctggattcgcgaagacgacctcgatgcagaactgcgtcagcgacaagga
tggactggtatcatctccttggcacgagttctcaaaatgcaggccttgacgggtgttacc
ggagccttgtcgtctccacttcaatctatcggttccatcgaattggtgcctgaagataca
catggctcgagcttcactgctatcacgctgtgcgcagtgcccgatcctcgattatgcaag
ctgagaggctgtaggtttccctcaaaggaaactccggagcaaagccccggaggtatcttt
gtgtttcctgtagcctggcggcagtgggagatggaactagaattcagaccagaagaaggc
gctgccaagttgggttttgatattgtacattcagctgcggaatttacccgcgtttacttt
gatgtaaatgcggagacgattgtcattgaccggagttgctccacatctctagatgggatc
cgaacatgtcaagaggaagcgcctcacacgctgttcacgattaggcagcggggcaaagac
agcccctttaccgaaaaggggatactcgaaaccttgaagttccacgtcttgtacgactcc
agcgtgcttcaggtgtttgtgaacgaacgcacagcactgaccacaagggtttatcccgct
ggcgggacgagcacgggtatccgcccgttggtggagcgaacatgttatcattctagcaac
actggagggccaaagtctcgggcttggaatatggctctgtggcctctctcgctttctgtc
taa

DBGET integrated database retrieval system