KEGG   Coraliomargarita akajimensis: Caka_1098Help
Entry
Caka_1098         CDS       T01204                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
caa  Coraliomargarita akajimensis
Pathway
caa00520  Amino sugar and nucleotide sugar metabolism
caa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Caka_1098
Enzymes [BR:caa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Caka_1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 3Beta_HSD RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-ProteinID: ADE54119
UniProt: D5EHS8
Position
complement(1388515..1389453)
Genome map
AA seq 312 aa AA seqDB search
MRILVTGGAGFLGSHLCDRLLEQGNEVICLDNYFTGRKRNISHLFGNPDFEIMRHDVIDP
FKVEVDQIYNLACPASPVHYQYNAIKTIKTSVMGAINCLGLAKRTGARVFQASTSECYGD
PSVHPQPESYWGNVNPIGIRSCYDEGKRCAETLFMDYHRQNGVDIRIVRIFNTYGPRMCP
DDGRVVSNFIVQALQGNDITVYGEGQQTRSFCYCDDLLNGFLKLMNQDELTGPVNIGNPG
EFTILELAEKVIALTGSQSKIIFEPLPADDPKQRQPDITLAREKLGWEPTVSLDEGLKPT
IAFFDRLLGEER
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattctagtaactgggggggccggatttcttggaagtcacctgtgtgatcgtctg
cttgaacaagggaacgaggtcatctgtttggataactattttaccgggagaaagcgtaac
attagccatctttttgggaatcccgattttgagatcatgcgccatgatgtgattgatccg
ttcaaagtcgaggtcgaccaaatctacaatttggcctgcccggcgtcaccggtgcattat
cagtacaatgcgattaagacgataaagacctcggtgatgggagcgatcaattgccttgga
ctcgcaaaacggacgggagcgcgggtctttcaggcttcaacatctgagtgttacggcgat
cctagtgtacacccgcagccggagagctactgggggaatgtgaatcccattggcattcga
tcttgttatgatgagggcaagcgttgtgcggaaacactctttatggattatcaccgccag
aacggggtcgacatccggattgtgcgtattttcaacacctatggtcctcgcatgtgtccg
gatgatggccgtgtggtatccaatttcatcgttcaagcgctccagggtaatgacatcacg
gtttacggagaagggcagcaaacgcgctctttttgttactgtgacgatctcttgaatggc
ttcttgaaattgatgaatcaggatgagctaactgggccagtgaatattggaaatccgggt
gagttcacgattcttgagttggctgaaaaagtgatcgcgctaactggcagtcagtcaaag
atcatttttgagccgcttccagcggatgatccgaagcagcgtcaaccagatattaccttg
gcgcgggagaagctaggctgggagccaaccgtatctctggatgaaggcttgaagccgacg
attgcattttttgaccgtttactgggtgaggagcgatag

DBGET integrated database retrieval system