KEGG   Chlamydia abortus S26/3: CAB624Help
Entry
CAB624            CDS       T00242                                 

Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cab  Chlamydia abortus S26/3
Pathway
cab00230  Purine metabolism
cab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cab00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CAB624
Enzymes [BR:cab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CAB624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 Cytidylate_kin AAA_22 Thymidylate_kin AAA_17 AAA_33 ABC_tran AAA AAA_23 AAA_30 TsaE Zeta_toxin Rad17 cobW AIF_C RNA_helicase
Motif
Other DBs
NCBI-ProteinID: CAH64070
UniProt: Q5L5M1
Position
complement(716644..717258)
Genome map
AA seq 204 aa AA seqDB search
MKNKVRVPFSPDHPLCAPKLFTISAPAGAGKTTLVRMLAREFPDSFQKTLSLTTRAPRPE
EIPGVDYQFVSQEEFQRRLDNEDFLEWVALFGEYYGTSRLGIDEIWKSGRHAVAVIDVEG
ALVLQSKIPTVAIFISAPSQEELERRLKQRGSEQDTQRQERLQHSLIEQAAADKFEYVII
NDDLEKSYEVLKSIFIAEEHRNVL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaagttcgtgttcctttttctcccgatcatcccctgtgcgcaccaaaatta
ttcactattagtgctcctgctggagctgggaaaacgacgctagtccgtatgttggctaga
gaattcccagattcttttcagaagactttatcactgacaacacgagcacctcgtcccgaa
gaaattcccggagtagattatcaatttgtttctcaagaggagtttcaacgacgcttagac
aatgaagattttcttgagtgggtagcactttttggtgagtattacggaacaagtcgtctg
gggattgatgaaatttggaaatctggaaggcacgcggtggcggtcattgacgtggaaggc
gctttggtcttacagagtaaaattcccacagtggcgatttttatttctgcaccatctcag
gaagagctagaaaggcgtctaaaacaaagaggatcagaacaagatactcaaagacaagag
cggttgcagcatagtcttattgaacaagctgcagctgataaatttgaatacgtcattatc
aatgatgatttggagaaatcttacgaggttttgaaaagtatttttatagcagaagaacat
aggaacgtattatga

DBGET integrated database retrieval system