KEGG   Caldithrix abyssi: Cabys_1807Help
Entry
Cabys_1807        CDS       T04549                                 

Definition
(GenBank) UDP-glucuronate decarboxylase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
caby  Caldithrix abyssi
Pathway
caby00520  Amino sugar and nucleotide sugar metabolism
caby01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cabys_1807
Enzymes [BR:caby01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Cabys_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind adh_short NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: APF18556
UniProt: A0A1J1C826
Position
2144190..2145137
Genome map
AA seq 315 aa AA seqDB search
MTGGAGFIGSHLCETLLNKGHDVLCLDNFFTGQKENIWHLMDDKRFELIRHDVTQPILLE
VDRIYHFACPASPIHYQYNPVKTIKTSVMGTIHMLGLAKRVRARIMLASTSEVYGDPKVH
PQKESYWGNVNPIGIRSCYDEGKRVAETLMMDYHRQNKVDIKIVRIFNTYGPRMAINDGR
VVSNFIIQALTNQNITVYGRGNQTRSFQYIDDLIDGVERMMNVEDFIGPVNLGNPHEFTI
LELAEKVIELTNSRSKIVFKPLPADDPVQRKPFIGLAKEKLDWEPRIKLEDGLKKTIAYF
DEVLSRLPDKKPIID
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgacaggcggcgcgggctttattggctctcatttgtgtgaaacgctgttgaacaaaggc
catgatgtattatgcctggataatttcttcaccggacaaaaggaaaatatctggcacctg
atggatgataaacgatttgagctgatccggcacgacgtgacgcagccgattttgcttgag
gtcgatcgcatttaccattttgcctgccccgcctctcctattcactatcagtacaatccg
gttaaaactattaaaaccagtgtgatgggtactattcacatgctgggcctggcaaaacgc
gtacgggcgcgcattatgctggccagcacgtctgaagtgtatggcgaccctaaagtgcat
ccacaaaaagaaagttactggggcaatgtcaatcccatcgggatacgcagttgttacgat
gaaggcaaacgcgttgcggaaacgctgatgatggattatcaccgtcaaaataaagtcgat
attaaaattgtgcggatttttaatacttatggaccgcgcatggcaatcaatgacggtcgg
gtggtcagtaattttatcattcaagctttaaccaatcaaaatattaccgtctatggtcgc
ggcaatcaaacgcgttcctttcaatacattgacgatttaattgatggcgtggagcgcatg
atgaatgtagaggattttatcggtcccgttaacctgggaaatccgcatgaatttaccatt
ctggaactggctgaaaaggtcattgaactgaccaattccagatcaaaaattgtttttaaa
cctctgccagcggatgatcccgtgcagcgcaaaccttttattggactggctaaagaaaaa
ttagactgggagcccaggattaaactggaagatggattaaaaaagacgattgcctatttc
gacgaggttctttccaggcttccggacaaaaaaccgatcattgattga

DBGET integrated database retrieval system