KEGG   Clostridium acetobutylicum ATCC 824: CA_C0015
Entry
CA_C0015          CDS       T00056                                 

Gene name
serA
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00260  Glycine, serine and threonine metabolism
cac00270  Cysteine and methionine metabolism
cac00680  Methane metabolism
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
cac01120  Microbial metabolism in diverse environments
cac01200  Carbon metabolism
cac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cac00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    CA_C0015 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CA_C0015 (serA)
   00270 Cysteine and methionine metabolism
    CA_C0015 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cac04147]
    CA_C0015 (serA)
Enzymes [BR:cac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     CA_C0015 (serA)
    1.1.1.399  2-oxoglutarate reductase
     CA_C0015 (serA)
Exosome [BR:cac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CA_C0015 (serA)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh Baculo_LEF5_C
Other DBs
NCBI-GeneID: 1116198
NCBI-ProteinID: NP_346662
UniProt: Q97N23
Position
22715..23632
AA seq 305 aa
MIRILANDGMNKNAVNGLIDLGYEVVEDHYDKDELLVKIKEFDVLVVRSATKVTKEVIDA
ATVKGAKLKLIIRAGVGVDNIDVTYARDKGLTVNNTPNASSASVAELAIGHMFAVSRFIN
TANVTMRQGKWEKKAYTGTEIFGKTLGLIGFGRIAREVAKRAEALGMKVIYNDICGKVVG
YDSYEFYDDINGLLREADFVSLHIPYDKKKGYVIGDNEFNAMKDGAFLINCARGGVVSEQ
ALLNAINNGKIRGAALDVFENEPKPCAEILDNPRVSVTPHIGASTKEAQARIGEEIVNIV
ENTFK
NT seq 918 nt   +upstreamnt  +downstreamnt
atgataagaatattagctaatgatggaatgaataaaaatgcagtaaatggattaatagat
cttggttatgaagttgtagaggaccattatgataaagacgaattacttgtgaaaataaaa
gaatttgacgttttagttgtaaggtctgcaacaaaagtaacaaaagaggttattgatgca
gcaacagttaaaggggcaaaacttaagcttattataagagctggagttggagtagataat
attgatgttacgtacgcaagagataaggggcttacagtaaataatacacctaatgctagc
agtgcttcagtagcagaactagccataggacatatgtttgcagtttcaagatttataaat
actgcaaatgtaactatgaggcaaggtaagtgggaaaagaaagcatacacaggaactgaa
atttttggaaaaacgttggggcttataggatttggaagaattgcaagagaggttgctaaa
agagcagaagcactaggtatgaaagtaatctataatgatatatgcggcaaagtagttggt
tatgatagctatgagttttatgatgatataaatggacttttgagggaggctgattttgta
tcacttcatataccgtatgataagaaaaagggatatgtaataggagataatgagtttaat
gcaatgaaagatggggcatttcttataaactgtgctaggggtggagttgtttcagaacaa
gcgcttttaaatgcaattaataatggcaaaataagaggggcagcgcttgatgtgtttgaa
aatgaaccaaaaccttgtgcagaaattttagataatcctagagtttcagttactccacat
ataggagcgtcaactaaggaagctcaagctagaataggtgaagaaatagtaaatatagta
gagaacacgtttaaatag

DBGET integrated database retrieval system