KEGG   Clostridium acetobutylicum ATCC 824: CA_C0100Help
Entry
CA_C0100          CDS       T00056                                 

Gene name
hemB
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00860  Porphyrin and chlorophyll metabolism
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
cac01120  Microbial metabolism in diverse environments
Module
cac_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CA_C0100 (hemB)
Enzymes [BR:cac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CA_C0100 (hemB)
Exosome [BR:cac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CA_C0100 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 1116283
NCBI-ProteinID: NP_346745
UniProt: Q97MU1
Position
109303..110265
Genome map
AA seq 320 aa AA seqDB search
MFRRHRRLRKNSYIRDMVRETTLSPNDFIYPLFVVEGINIKKEIPSLPNNYHYSLDRLPE
VISEINDAGVKGIILFGIPDYKDEIGSSAFDENGIIQKAIRKIREIDKDLFIITDVCMCE
YTSHGHCGIIHDGYVDNDETLKYIGKIALSHAKAGADMIAPSDMMDGRIEEIRTTLDENG
YKNVSIMAYSAKYCSAFYGPFRDAADSAPKFGDRKSYQMDPANAREAMLEIEDDIEEGAD
VIMVKPALAYLDILRTAKNRFDVPVAAYSVSGEYSMIKAGAKMGWIDEKAIALESLLSIK
RAGADMIITYYALEASKWLK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagacatagaagattaagaaagaatagctatataagggatatggtaagagag
actacattaagccctaatgactttatttatccgctttttgtggtagaagggataaatata
aaaaaggaaataccatcactgcctaataattatcattattctttagacaggctaccagag
gttatttctgaaattaatgatgcaggtgttaaaggtataattttatttggaataccagat
tataaggatgaaattggttcttctgcttttgatgagaatggaataattcaaaaggcaata
agaaaaataagagaaattgataaagatctatttataataacagatgtatgtatgtgtgaa
tatacaagccatggacattgcggaattattcatgatggatatgttgataatgatgaaact
ctaaaatatataggaaaaatcgcactctctcatgcaaaggcgggagctgacatgattgca
ccgtcagacatgatggatggtagaattgaagaaattaggactactcttgatgaaaacgga
tataagaatgtatctataatggcatatagtgctaaatattgttctgcgttctatggtccg
ttcagagatgctgcggattctgcacctaaatttggagatagaaagagctatcaaatggac
cctgcaaatgcaagagaggctatgcttgagattgaagatgatattgaagaaggcgctgat
gtaataatggtcaagcctgcactagcgtaccttgatatattaagaactgctaaaaataga
tttgatgttccagttgctgcatacagcgttagtggtgaatattcaatgataaaggctgga
gccaaaatgggctggatagatgaaaaggctatagcacttgaatctttattatcaattaaa
agagctggtgctgatatgattataacttattacgcattggaagcttcaaagtggttaaag
tag

DBGET integrated database retrieval system