KEGG   Clostridium acetobutylicum ATCC 824: CA_C0365Help
Entry
CA_C0365          CDS       T00056                                 

Definition
(RefSeq) phosphoglycerate dehydrogenase
Organism
cac  Clostridium acetobutylicum ATCC 824
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN F420_oxidored AlaDh_PNT_C Shikimate_DH DpaA_N Pyr_redox_2 AlaDh_PNT_N Pyr_redox
Motif
Other DBs
NCBI-GeneID: 1116548
NCBI-ProteinID: NP_347005
UniProt: Q97M35
Position
424172..425119
Genome map
AA seq 315 aa AA seqDB search
MKTKALFTFHFSEDEIKNLEELGFEIILRREKDLKYTKELEDVEFMFTYNPFKHFDIAKL
KKLKWIQLESDGFEQIPKEYTKNNGIIVTNNKNGYSVPISEWIVWSILSTYKEANIFFQN
KQDKKWKLRTSLREIFGETVGILGTGHIAIETAKRLQAFGVNVLGLNTTGRKVEYFNECY
AKDRVEEMIKECDVVVSLLPITDETHHFINERIFLLMKNGVVFVNASRGKVVEEEKLIKF
LKNGKIRAAALDVVEEEPLSKDSPLWQMNNVIITPHNSWISQNMAKRKYKLVYENMRRYK
AGEQLKNIVDLQKGY
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaactaaggctttatttacttttcatttttctgaggatgaaataaaaaatcttgaa
gaacttgggtttgaaataatcttgagaagagaaaaagacttaaaatatacaaaagagctt
gaagatgtagagtttatgtttacctataatccatttaagcatttcgatatagctaagctt
aaaaaattaaagtggattcaacttgaaagtgatggttttgaacaaattccaaaggagtat
actaaaaataacggaattatagttactaataataaaaatggctatagtgtgcctatttca
gagtggatagtttggagcattttatctacctacaaagaggcaaatattttctttcagaat
aagcaggataaaaaatggaagcttagaacctctcttagagagatttttggagaaactgta
ggaatacttggcactggacatatagctattgaaacagcaaaaagacttcaagcttttggg
gttaatgttttgggacttaatactacaggcagaaaagtagagtatttcaatgaatgttat
gctaaggatagggtagaggaaatgattaaagagtgtgatgtagtagtatcacttctacct
attacagatgagacacatcactttattaatgaaagaatttttttattgatgaaaaatgga
gtggtttttgtaaatgcatcaaggggtaaggtagttgaagaagagaaattaataaagttt
cttaagaatggtaaaatacgtgctgcagctttggatgttgttgaagaagagcctttaagt
aaggatagtcctctttggcaaatgaataatgtgattataactccgcacaattcttggatt
tcacaaaacatggctaaaagaaagtataagttagtttatgaaaacatgagaagatataaa
gcaggagaacagcttaaaaatatagtggatttacaaaagggatattag

DBGET integrated database retrieval system