KEGG   Clostridium acetobutylicum ATCC 824: CA_C0578Help
Entry
CA_C0578          CDS       T00056                                 

Gene name
metH
Definition
(RefSeq) B12-dependent methionine synthase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00270  Cysteine and methionine metabolism
cac00450  Selenocompound metabolism
cac00670  One carbon pool by folate
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
cac01230  Biosynthesis of amino acids
Module
cac_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:cac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CA_C0578 (metH)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CA_C0578 (metH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CA_C0578 (metH)
Enzymes [BR:cac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     CA_C0578 (metH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Met_synt_B12 S-methyl_trans Pterin_bind B12-binding_2 B12-binding
Motif
Other DBs
NCBI-GeneID: 1116761
NCBI-ProteinID: NP_347216
UniProt: Q97LI3
Position
complement(667538..671176)
Genome map
AA seq 1212 aa AA seqDB search
MNSSLKNLLNNKILVLDGAMGTCIQSFNLDEGDFKGSLSCTCHSNQKGNNDVLNLTKPEI
IKEIHKRYLEAGADIIETNTFNATEISQKDYNMQDKIYDINFKGAKLAKEACTYYTKLNP
NKPRFAAGSIGPTNRTASLSPDVENPGFRNVTFDELCNAYKHQIEALIDGGVDLLLIETI
FDTLNARAAIFAAETVFENKKIKLPIIISGTIADKSGRILSGQTLDAFAESLKNENIIAI
GLNCSFGAEELIPFIKRLSETQNRYISFHPNAGLPNSLGEYEELPEETASIVKKLALEGH
LNIVGGCCGTTPEHIRAISSVVKGISPRKVPNLEPKTIYSGLENIKIDKNSNFINIGERT
NVAGSRKFARLIREKNYEEALTIARHQVENGAQIIDINFDDALLDARSEMETFLRLIASE
PEISKVPVMIDSSNFEVLKVGLKSIQGKAIVNSISLKVGEEKFIEEAKFIKNFGAGVVVM
AFDEEGQAATYERKIEICKRAYTILTEKVEFPPENIIFDPNILSIATGIEEHDNYAVNYI
KAVKWIKENLPYAKVSGGVSNLSFSFRGNDAIRRAMHSVFLYHAINAGMDMGIVNPAMID
LYDDIDKDLLEKVENVVLNKSSNASESLLEFAQTYKKTTETLEKHEDEWRQKSPSERLSY
ALVKGNVEFIEEDIEEARKEYTNALEIIEVPLMNGMKKVGKLFGEGKMFLPQVVKSARVM
KKAVECLLPYINEEKSKNHNKSAGKVVFATVKGDVHDIGKNIVSVVLSCNNFEVIDLGVM
VPPETILETAKRENADIIALSGLITPSLNEMAYVAEEMKRLNFDIPLMVGGAATSKTHTA
LKLATKYKYVVHSTDASDAVTVAKNLMSENKFTFLEKLNEEYSKIRETFSTNKIELISIQ
NARKNRFTIDWNKTKITEPKFVGIKKLQAVPINELRKYIDWTFFFTSWDMGMNYPKIMKD
PKYGAEAQKLFKDANEMLDLLQKENLITCNGVFGIFPANSVNDDIEIYTDKGTVTINTLR
QQQILKDSDYKALSDYIAPKGIGIKDYIGGFIVTAGIGAKEYSDKLKKKCDDYGATMLKL
ICDRLAEAFSELLHLRVRKEYWGYSQDENLSLEKLLKGSYRGIKPAIGYPSIPDHSEKAK
LFDLLLGKTSIGVELTESYMMNPTSSVCGLYFANERAKYFNINKIGKDQLEDYAVRSNKD
INEIKKLLDTLL
NT seq 3639 nt NT seq  +upstreamnt  +downstreamnt
atgaattcttcactaaagaatttgttaaataacaaaattttagttttagatggtgctatg
ggaacatgtattcaatcctttaatctagatgaaggcgactttaaaggttccttatcttgt
acatgtcattccaatcaaaaaggaaacaatgatgttttaaatttaaccaagccagaaata
ataaaagaaatccacaagagataccttgaagctggcgcagatataatagaaacaaacact
tttaacgctactgaaatatcacaaaaagattataatatgcaagataaaatatatgatatt
aattttaagggggcaaaactcgcaaaggaagcttgtacttactacacaaaactaaatcct
aataagcctagatttgctgctggttctattgggcctacaaatagaactgcttctctatct
ccagatgttgaaaatcctggttttagaaatgtaacctttgatgagctatgtaatgcctat
aaacatcaaatagaggctctaatagatggaggtgtagaccttcttttaattgaaactata
tttgatactttaaacgctagagcagcaatctttgcagcagaaacagtatttgaaaataaa
aaaataaaacttcctattataatttcagggacaatagctgataaaagtggaagaatatta
tccggtcaaactcttgacgcttttgcagaaagtttaaaaaacgaaaatataattgctata
gggcttaattgttcctttggtgctgaagaacttataccttttataaaaagactctctgaa
acacaaaatagatatatatcctttcatccaaacgcaggacttccaaactcccttggtgaa
tatgaagaactgccagaggaaactgctagcattgtaaaaaaattagcacttgaaggacat
ttaaatatagttggaggctgctgtggcactacaccagaacatataagagcaataagcagc
gtagttaaaggcatttctccaagaaaagttccaaacttggaacccaaaacaatttacagc
ggactagaaaacataaaaattgataagaacagtaacttcataaatataggcgaaagaaca
aatgtagcgggctcaagaaaattcgcaaggcttatacgtgaaaaaaattatgaggaggct
ctaaccattgcaagacatcaggttgaaaatggtgcccaaattatagatataaattttgat
gatgcacttttagatgctcgctctgaaatggaaacatttttaagacttattgcaagtgaa
cctgaaatatcaaaagttccagttatgatagactcctctaattttgaagttttaaaagtt
ggattaaagtctattcaaggtaaagccatagtaaattccataagtcttaaggttggagaa
gaaaagttcattgaagaggcaaaatttataaagaactttggcgctggcgtagttgtaatg
gcctttgacgaagaaggtcaagcagctacttatgaaagaaaaattgaaatctgcaagaga
gcttatactattctcacagaaaaagttgagtttccacctgaaaatataatatttgatcca
aatatactatctatagcgacaggaattgaagaacatgacaactatgcagttaattacata
aaagctgttaaatggataaaagagaatctaccatacgctaaagtcagcggtggagttagc
aacctctccttttcttttaggggtaatgacgcaataagaagagctatgcattctgttttc
ctttaccatgcaataaacgctggaatggatatgggtattgttaatccagcaatgattgat
ttatatgacgatatagataaggatcttctcgaaaaggttgagaatgttgtactaaataaa
tcatctaacgcttctgaatcattactagaatttgctcaaacgtataaaaagacgactgaa
accttagaaaagcacgaggatgaatggcgacaaaaaagcccaagtgaaaggttgagttat
gctttagttaaaggaaatgttgaatttattgaagaagatatagaagaagcaagaaaagag
tatacaaatgcacttgaaattatagaggttcctttaatgaatggaatgaaaaaagtgggt
aaactttttggagagggaaaaatgtttcttcctcaagtagtaaaaagtgctagagttatg
aaaaaggctgttgaatgtcttcttccctatataaacgaagaaaagtctaaaaatcacaat
aaaagtgctggtaaggttgtatttgcaactgttaaaggcgatgttcatgacataggcaaa
aatatcgtatctgtagttctttcctgcaacaattttgaagttatagatttaggagtaatg
gttccccctgaaaccatacttgaaacggcaaaacgtgaaaatgcagatatcattgcttta
agtggtttaattacaccttctcttaatgaaatggcttatgtagctgaagaaatgaaaagg
cttaattttgatataccacttatggtgggtggtgctgctacctcaaaaactcacacagct
ttaaaactagctacgaaatataaatatgtagtacacagtactgatgcttcagatgctgtt
accgtagccaaaaatctaatgagtgaaaacaaatttactttcttagaaaaattaaatgaa
gagtattctaaaataagagagaccttctctactaataagattgaacttatctccattcaa
aacgcaagaaaaaacagatttactattgactggaataaaactaaaataactgaacctaaa
tttgtcggtataaaaaaattacaagctgtacctataaatgaattaagaaagtatatagat
tggactttcttctttacgtcttgggatatgggaatgaattaccccaaaataatgaaagat
cctaaatacggagctgaagctcaaaaactctttaaggatgccaatgaaatgcttgattta
ttgcaaaaagaaaatttaatcacttgtaatggagtttttggaatattcccagctaattct
gttaatgatgatatagaaatctacactgataaaggaactgtaaccataaatactcttcgt
cagcagcagatacttaaagacagcgattataaagctctatctgattatatcgctccaaag
ggtattggcatcaaagattatataggtggttttattgtaactgctggaataggtgcaaag
gaatattccgataaattaaagaaaaaatgcgacgattatggagctactatgcttaaactt
atatgcgatagacttgcagaggccttttcagaacttcttcacctaagggtaagaaaagaa
tactggggatactctcaagatgaaaacttatccttagaaaaacttcttaaaggaagttac
agagggataaaaccagctattggatatccttctattcccgatcactctgaaaaagcaaag
ttatttgatttacttttaggtaaaacttcaataggagtggaattgacggaaagttatatg
atgaatccaacttcaagtgtatgcggtttgtattttgcaaatgaacgagcaaaatacttt
aatataaataaaataggaaaagatcaacttgaggactatgctgttcgaagtaataaagac
attaatgaaataaaaaaattattagatactctgttataa

DBGET integrated database retrieval system