KEGG   Clostridium acetobutylicum ATCC 824: CA_C0826Help
Entry
CA_C0826          CDS       T00056                                 

Definition
(RefSeq) endoglucanase 5
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00500  Starch and sucrose metabolism
cac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CA_C0826
Enzymes [BR:cac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CA_C0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase Glyco_hydro_97 Glyco_hydro_35
Motif
Other DBs
NCBI-GeneID: 1117009
NCBI-ProteinID: NP_347462
UniProt: Q97KU0
Position
complement(956696..957808)
Genome map
AA seq 370 aa AA seqDB search
MFKNLFSKAKISLLTFAFLGTSLSGAYSACAATVNPHDMTSQQIVNDMKVGWNLGNTLDA
SPDETGWGNPKTTKAMIDKIKEAGFNTVRIPVSWSSHIGAGPSYTIDQAWLNRVQEVVNY
VIQDHMYAILNTHHDTSWIIPTYNKEAASTDELTKVWGQIANRFKDYDSHLIFETLNEPR
IVGSPEEWNGGTAESRDVINKFNLTAVNTIRSTGSNNSSRFIMVPTYAASTATAAMNDLV
IPNNDKRVIVSLHMYAPYSFAMDPKGTSHWGGEADKDALDGQLNAIYNKFVKNGQPVVIG
EFGSINKNNESSRASLAKFYVSDARKKGITTVWWDNGKSAVGDDNYGILDRNNLTWVFPK
LVRTIVNSAR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaatttattttcaaaagcaaaaatttcacttctaacatttgcttttctagga
acatctttatcaggagcttatagtgcatgtgccgcaactgtaaatccacatgatatgaca
tcacaacaaattgttaatgatatgaaggttggttggaatctaggaaacactttggatgct
tctccagatgaaacaggttggggaaatcctaaaactacaaaggcaatgattgacaaaatt
aaagaagctggctttaatactgtaagaatacctgtatcttggagtagccacataggtgct
ggtcctagctacactattgatcaagcttggcttaatagagttcaagaagtagttaattat
gtaatccaagatcatatgtatgctatattaaatactcatcatgatacttcttggattata
ccaacttacaataaagaagctgcatcaactgatgaactcacaaaggtttggggacaaatt
gcaaatcgttttaaagactatgatagtcatttaatttttgaaacattaaacgaacctaga
atagttggttcacctgaagaatggaatggtggaactgctgaatctcgtgatgtaattaat
aaattcaatttaactgctgtaaatactataagaagtactggttcaaataactcatctaga
tttattatggttccaacttacgcagcttctacagcaactgctgctatgaatgatttagtt
ataccaaacaacgataaaagagtaatagtttcactacacatgtatgctccatatagtttt
gcaatggatcctaaaggaacttcccattggggaggagaagcagataaggatgcgctcgat
ggccaacttaatgcaatttacaataaattcgtaaaaaatggtcagcctgtagttataggc
gaatttggttcaattaataaaaataacgaaagttcaagagcatcattagcaaaattttat
gtttcagacgcaagaaaaaaaggaataaccacagtatggtgggataatggcaaatctgct
gttggagacgataattacggtatattagatagaaataatctaacatgggtttttccaaaa
ctcgtaagaacaatagttaactcagctagatag

DBGET integrated database retrieval system