KEGG   Clostridium acetobutylicum ATCC 824: CA_C1054Help
Entry
CA_C1054          CDS       T00056                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00220  Arginine biosynthesis
cac00330  Arginine and proline metabolism
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
cac01130  Biosynthesis of antibiotics
cac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    CA_C1054
   00330 Arginine and proline metabolism
    CA_C1054
Enzymes [BR:cac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CA_C1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 1117237
NCBI-ProteinID: NP_347690
UniProt: Q97K65
Position
complement(1209680..1210579)
Genome map
AA seq 299 aa AA seqDB search
MNIDILGVPIYYGSDRKGVDLGPSKLREKNLASLIAKYNHNVKDMGDVNVPFISEKDKFK
FNDKMKFLKPIVEANTELANKVYESLSSGNFPFVVGGDHSLGLGSITGASKALDNLAVIW
IDAHTDINTDKTTETGNVHGMPLSAAMGIGASELTNICYNGQKVKPENVFIIGARSIDKG
ELALIYEKNLTFYSTKTVKRLGVEYILKEITEKLSKNNINSVHLSFDIDCLDETIVPGTG
TPVSDGLNVDDTKLMVESLVKSGLVKSMDLVEFNPALDKDHQTEDLVMEFIDCIFKNLK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgatatattaggcgtacctatctactatggttctgatagaaaaggagtagat
ttaggtcccagcaagttgagagaaaaaaatttagcgtcacttatagccaagtacaatcac
aatgttaaagatatgggcgatgttaatgtaccatttatatccgaaaaggataaatttaaa
ttcaatgataaaatgaaatttttaaagcccatagttgaagcgaatacagaactcgcaaac
aaggtttatgaatcactatcctccggaaactttccatttgtagtaggaggtgaccattca
ctcggtcttggcagcataacgggtgcaagtaaagctcttgataaccttgcagtaatatgg
attgacgctcacacagatataaacacagacaaaaccacagaaacaggtaatgttcacgga
atgcctttatctgctgcaatgggtattggtgcaagcgaacttacaaacatatgctataac
ggtcaaaaagtgaaaccagaaaatgtgttcataataggagcaagatcaattgataagggt
gaattagctctaatttatgaaaaaaaccttaccttctattcaacaaaaaccgtaaagaga
ttaggtgttgagtatattctcaaagagattaccgaaaagctttcaaaaaataatatcaat
tcagttcatctaagttttgatatagattgtcttgatgaaaccatagtaccaggaacagga
acaccggtttctgatggtctaaatgtagacgatactaaactaatggtagaatctcttgtt
aaaagcggtcttgttaagtccatggatcttgttgaatttaatccagctttggataaagat
catcaaactgaagatttagttatggagtttattgactgtatttttaaaaacttaaagtag

DBGET integrated database retrieval system