KEGG   Clostridium acetobutylicum ATCC 824: CA_C1394Help
Entry
CA_C1394          CDS       T00056                                 

Gene name
purN
Definition
(RefSeq) phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00230  Purine metabolism
cac00670  One carbon pool by folate
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
Module
cac_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:cac00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CA_C1394 (purN)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CA_C1394 (purN)
Enzymes [BR:cac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     CA_C1394 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N Peripla_BP_4
Motif
Other DBs
NCBI-GeneID: 1117577
NCBI-ProteinID: NP_348022
UniProt: Q97J92
Position
1538029..1538643
Genome map
AA seq 204 aa AA seqDB search
MYKIAVLVSGGGTDLQSIIDAIEEGYIKNCIIEAVISDKKGAFAIERAKKHGIKSYTFDR
KEYKGTVCDEVLKLLYKKVDLIVLAGFLSILKGDLLNKFKNRIINIHPSLIPAFCGNGMY
GMKVHEKAIEYGVKISGCTVHFVDEGTDSGPIILQSAVEVLATDTPDTLQKRVLEAEHKL
LPEAVKVLSEGKVQIEGRHVKVIK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaatagctgttctcgtgtcagggggcggaacagaccttcaatctataattgat
gccattgaagaaggatatataaaaaattgtataatcgaggctgtcataagcgataaaaaa
ggggcttttgcaatagaaagagcaaagaaacatggtataaaaagttatacctttgataga
aaagaatataagggaactgtatgtgatgaggtattaaaattgctttataaaaaggtggat
ttaatagtccttgcgggttttctttcaatactaaaaggtgatttgctaaataaatttaaa
aataggataataaatatacatccttcccttataccagcgttttgtggaaatggaatgtat
ggcatgaaggttcatgaaaaagctatagagtacggagttaaaatttcaggttgtactgtt
cattttgtagatgaaggaacagacagtggaccgataattcttcaaagtgcggtagaggtt
ctcgcaactgatacaccagatacacttcaaaaaagagttttagaggcagaacataagctt
cttccggaggcagtaaaggtattatcagaaggaaaagttcaaatagaaggaagacatgta
aaagttattaaataa

DBGET integrated database retrieval system