KEGG   Clostridium acetobutylicum ATCC 824: CA_C1723Help
Entry
CA_C1723          CDS       T00056                                 

Gene name
fmt
Definition
(RefSeq) methionyl-tRNA formyltransferase
  KO
K00604  methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00670  One carbon pool by folate
cac00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CA_C1723 (fmt)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CA_C1723 (fmt)
Enzymes [BR:cac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     CA_C1723 (fmt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N Formyl_trans_C
Motif
Other DBs
NCBI-GeneID: 1117906
NCBI-ProteinID: NP_348349
UniProt: O05101
Position
1872002..1872934
Genome map
AA seq 310 aa AA seqDB search
MLKIVFMGTPEFSVPSLEKLIENYDVRAVLTQPDKPKGRGKKLAMSEVKEVAVKNNIPVF
QPVKLKNDIEVINKLKEIAPDFIVVVAFGQILSKEVLDIPKYACINLHASLLPNYRGAAP
INWAIINGETKTGNTTMIMAEGLDTGDMLLKDEVDIKRDMTAGELHDILMNRGADLLVKT
IDEFSKGNIKPEKQGEPETDYAAMLSKDTGKINWNDKSERIYNLIRGLNPWPLAYSSYND
KVMKIHEAKILDAAPEGEPGLITNVDNNGIEVNSSDGKILITKIQFPGKKSMNVGEYIRG
NNIDKGVILK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaaaattgtgtttatgggaacaccggaattttcagtaccctcccttgagaaactt
atagaaaattatgatgtaagggctgttttgacgcagccagataagcctaagggacgtggg
aaaaagctagctatgtctgaggttaaagaagtagcagttaaaaacaatattccagtgttt
caaccagttaaattaaaaaatgatattgaagttataaataaattaaaagaaatagcacca
gattttatagtagttgtggcatttggtcaaattttatcaaaggaagttcttgatatacct
aagtatgcatgtataaatctgcatgcatctcttttgccaaattatagaggcgctgcacct
ataaattgggcaattataaatggagaaacaaagacaggaaatacaactatgattatggct
gaaggattggatacaggtgatatgcttcttaaggatgaagttgatataaaaagagatatg
acagcaggtgaacttcatgatattttgatgaatagaggagcagatcttcttgtaaaaacc
atagatgaattttcaaaaggaaacattaaaccagaaaaacaaggtgagccagaaacggat
tatgctgctatgttatccaaggatactggaaaaataaattggaatgataaaagcgaaaga
atatataaccttataagaggattaaacccatggcctcttgcgtattctagttataatgat
aaggttatgaaaattcacgaagctaaaatattagatgctgcacctgaaggagaaccaggt
cttataactaatgtagataacaatggaatagaagttaattcatcagatggaaagatttta
attacaaaaattcagtttccaggtaaaaaatctatgaatgttggggaatatataagagga
aacaatattgataagggagttattttaaagtaa

DBGET integrated database retrieval system