KEGG   Clostridium acetobutylicum ATCC 824: CA_C2223Help
Entry
CA_C2223          CDS       T00056                                 

Gene name
cheD
Definition
(RefSeq) chemoreceptor glutamine deamidase CheD
  KO
K03411  chemotaxis protein CheD [EC:3.5.1.44]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cac00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    CA_C2223 (cheD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cac02035]
    CA_C2223 (cheD)
Enzymes [BR:cac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     CA_C2223 (cheD)
Bacterial motility proteins [BR:cac02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CA_C2223 (cheD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheD
Motif
Other DBs
NCBI-GeneID: 1118406
NCBI-ProteinID: NP_348840
UniProt: Q97GZ2
Position
complement(2313672..2314172)
Genome map
AA seq 166 aa AA seqDB search
MEERENIKEIRVGIADLNTAFSPNRIITVGLGSCIGIAIYDSKNKLGGLSHIMLPDSTQF
SKVTNPYKFADLAIPILIKKMEGMGANIRNMKAKIAGGASMFNFSDKNMNMDIGNRNGIS
VKKVLKELNVPLLSQDIGGNKGRTMIFNTLDGSVDIRTVGMGIRKI
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagagagaacataaaagagataagggtaggaatagcagatcttaatactgca
ttttctccgaataggataataactgttgggttaggttcatgtattggcatagctatttat
gatagtaaaaataaattaggaggactttcgcatataatgcttcctgatagcacacaattt
agtaaggtaacaaatccttataagtttgctgatttagcaattcctatacttataaagaaa
atggagggaatgggtgctaatattagaaatatgaaagctaaaatagcaggtggagcatca
atgtttaatttttcggataaaaatatgaacatggatataggcaatagaaatggtatatca
gttaagaaagtacttaaagaattaaatgtaccattgttaagtcaagatattggaggaaat
aaaggcagaacaatgatttttaatactcttgatggaagtgtcgatattagaacagttggt
atgggtattagaaaaatttag

DBGET integrated database retrieval system