KEGG   Clostridium acetobutylicum ATCC 824: CA_C2249Help
Entry
CA_C2249          CDS       T00056                                 

Definition
(RefSeq) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00250  Alanine, aspartate and glutamate metabolism
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CA_C2249
Enzymes [BR:cac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CA_C2249
Peptidases [BR:cac01002]
 Cysteine Peptidases
  Family C44
   CA_C2249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase
Motif
Other DBs
NCBI-GeneID: 1118432
NCBI-ProteinID: NP_348866
UniProt: Q97GW6
Position
2343753..2344493
Genome map
AA seq 246 aa AA seqDB search
MIVITSFALSGECADEIFGGYPWFMRKEMIYANTFPWSRFVNERISLLSDDLKSINLQEY
VDARYKENLNNVPVSDEDSPYAKRMRELFYLNIKWFMITLLTRKDRMSMANSLEVRVPFA
DYRLVEYAFNIPPEIKFLNGREKGILRKAFEGVLPQDVIERKKSPYPKTFDPRYTALVQK
WLKKVVEDKTSPILDIIDLKTVNELIETGGSSYKTPWFGQLMKGPQLIAYLLQVNFWLKE
YKIKMI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgattgttatcaccagctttgcgctatcaggtgaatgtgcagatgaaatatttggaggt
tatccttggttcatgagaaaagaaatgatatatgctaacacttttccatggtctagattt
gtaaatgagagaataagccttttatccgatgatttaaagtctataaatcttcaagaatat
gtagatgcaagatataaagaaaacttaaataatgttcctgtttctgatgaggatagtcct
tatgccaaaagaatgcgtgaactcttctatttaaatataaagtggtttatgataaccctt
cttactagaaaagataggatgagcatggcaaatagtcttgaagttagagttccttttgct
gattataggctagttgaatacgcttttaatatacctccagaaattaaatttttaaacgga
agagaaaagggaattctaagaaaagcttttgagggcgttctacctcaagacgttatagaa
agaaagaagagtccttatccaaagacttttgatcctagatacacagctttggttcaaaaa
tggttaaaaaaagtggtagaggataagacatctcctattttagatataatagatttaaaa
actgtaaatgagctcattgaaactggcggctcttcttacaaaacaccttggtttggtcaa
ctcatgaagggacctcaattaatagcctatcttcttcaggtaaatttttggcttaaagaa
tataaaataaaaatgatataa

DBGET integrated database retrieval system