KEGG   Clostridium acetobutylicum ATCC 824: CA_C2277
Entry
CA_C2277          CDS       T00056                                 

Gene name
secF
Definition
(RefSeq) preprotein translocase subunit SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac03060  Protein export
cac03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cac00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    CA_C2277 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CA_C2277 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cac02044]
    CA_C2277 (secF)
Secretion system [BR:cac02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   CA_C2277 (secF)
SSDB
Motif
Pfam: SecD_SecF EI24 Sec_GG Inos-1-P_synth RanGAP1_C WhiA_N
Other DBs
NCBI-GeneID: 1118460
NCBI-ProteinID: NP_348894
UniProt: Q97GT8
Position
complement(2380114..2381016)
AA seq 300 aa
MLKVIKHTKVWFGISLTIIFLGIAFMIYRGVTTGKPLEFGIDFVGGNSMDIKIGKSFNKT
DVEKIVDKYIKDSTITTVNNTEVEIKSSTMTDAIGNKIFKDMQKKYNLKSKALVSQEKIG
GTIGQELKTKALIALAIALVIILLYIAWRFEFKFGVAAMISLVHDVLVTLAVYGIFAIPL
NSPFIAGMLTIVGYSMSDTIVVFDRIRENSRKHRRMSTSEIADFSINETLTRSIYTVLTV
LIAVSSVHVFVPSVRDFTKPLLVGIVSGCYSSIFIASPLWVIFKERANKKKLQIKAEAQK
NT seq 903 nt   +upstreamnt  +downstreamnt
atgcttaaggttattaaacatactaaagtttggtttggtatatctcttactataatattt
ttaggaattgcattcatgatatatagaggagttactacaggaaaacctttggaatttggt
atagattttgttggaggaaactcaatggatataaagatagggaagtcctttaacaaaact
gatgttgaaaagatagtagataaatatataaaagatagtactataaccacggttaataat
actgaggttgaaataaaaagtagtaccatgacagatgctattggtaacaaaatatttaag
gatatgcaaaaaaaatataatttaaaatcaaaggccttggtttctcaagagaagatagga
ggaactataggacaggaacttaaaacaaaagcgttgattgcacttgcaattgcactggta
attatacttttgtacatagcttggagatttgaatttaaatttggtgtagcagctatgata
tcgttagttcatgatgtacttgtaacacttgcggtatatgggatttttgcaataccatta
aattcaccatttatagctggaatgctaacaatagtaggatattctatgagtgatactata
gttgtttttgatagaataagagaaaatagcaggaagcatagaagaatgagtacatctgaa
attgctgattttagtataaatgaaactttgacaagatcaatttatacggttctaactgtt
ttaatagcagtctcttcagtacatgtattcgttccatctgtaagagattttacaaagcct
ttacttgttggtatagtttctggatgctattcttcaatatttatagctagtccattatgg
gttatatttaaggaaagagctaacaaaaaaaagctccaaattaaagcagaagctcaaaaa
taa

DBGET integrated database retrieval system