KEGG   Clostridium acetobutylicum ATCC 824: CA_C2335Help
Entry
CA_C2335          CDS       T00056                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00040  Pentose and glucuronate interconversions
cac00052  Galactose metabolism
cac00500  Starch and sucrose metabolism
cac00520  Amino sugar and nucleotide sugar metabolism
cac01100  Metabolic pathways
cac01130  Biosynthesis of antibiotics
Module
cac_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CA_C2335
   00052 Galactose metabolism
    CA_C2335
   00500 Starch and sucrose metabolism
    CA_C2335
   00520 Amino sugar and nucleotide sugar metabolism
    CA_C2335
Enzymes [BR:cac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CA_C2335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 1118518
NCBI-ProteinID: NP_348951
UniProt: Q97GN1
Position
complement(2442463..2443374)
Genome map
AA seq 303 aa AA seqDB search
MRVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVQSGIEEILVITGRNK
RAIEDHFDKSFELESELESHNKKELLKVVKDISNLANIYYIRQKEPRGLGHAINCARTFV
GNEPFAVLLGDDVVNAKVPCLKQLINCYNEYKTSILGVQRVPNSEVSKYGIVNGMHIEDG
VYKVKDLVEKPKQEEAPSDLAILGRYIITPSIFDILDNTKPGKGDEIQLTDALKTLMKTE
AMYAYVFSGRRYDVGDKLGFLQATVEYALKREELKKPFMNYLFTIKDNPNFKSLYDELNK
KSK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaaaaaagctataataccagcagcggggttaggaacaagatttttaccagca
actaaggcacaacctaaggaaatgcttcctatagttgataagcctacaatacagtatata
attgaagaagcagtacaatcaggaatagaagaaatacttgttattacaggaagaaacaaa
agagctatagaggatcattttgataaatcatttgaacttgaaagtgaacttgagagtcat
aacaaaaaagaacttcttaaggttgtaaaagatatatctaatttagctaatatatactat
atacgtcagaaggaaccaagaggccttggacatgcaattaattgtgctagaacttttgta
ggtaatgaaccatttgcagttttattaggtgatgatgtagtaaatgcaaaggtaccatgc
ttaaagcaacttataaattgttataatgagtataaaacttccatattaggagttcaaagg
gtgcctaattcagaggtgtcaaaatatggtatagtaaatggcatgcatatagaagatgga
gtttataaggtaaaggatttggttgaaaagccaaaacaagaagaagcaccttccgattta
gctatactaggaagatacataataactccatctatatttgatatattagataacactaaa
ccaggtaagggtgatgaaattcaacttacagatgcacttaaaacacttatgaaaacagaa
gcaatgtacgcttatgtattctcaggaagacgatatgatgttggagataaattaggtttc
cttcaagctacagttgagtatgcattaaagagagaagagcttaaaaaaccatttatgaac
tatttatttactataaaagataatcctaattttaaatctttatatgacgaattaaacaaa
aagagtaaatag

DBGET integrated database retrieval system