KEGG   Clostridium acetobutylicum ATCC 824: CA_C2537Help
Entry
CA_C2537          CDS       T00056                                 

Definition
(RefSeq) phosphatase
  KO
K19302  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cac00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CA_C2537
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cac01011]
    CA_C2537
Enzymes [BR:cac01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     CA_C2537
Peptidoglycan biosynthesis and degradation proteins [BR:cac01011]
 Precursor biosynthesis
  Diphosphatase
   CA_C2537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAP2 PAP2_3 PAP2_C
Motif
Other DBs
NCBI-GeneID: 1118720
NCBI-ProteinID: NP_349149
UniProt: Q97G34
Position
complement(2646809..2647390)
Genome map
AA seq 193 aa AA seqDB search
MNMELFRIINNLASKNEVFDKVMIFFSKDVPYLYTAILAVVFVLGIVKNKGNYRKSVFSS
FVITVINLIFSFAIGKLYYEDRPFVHNKVNLLVQHSKDASFPSDHATGTMSIALGLRNYN
KLISRILILISLIVGFSRVYVGNHYPMDVLGAYIMVFVTNYIYNLKLRNKVENLYEAVEK
KIFRVLGIKFLIQ
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggagctttttagaataataaacaatttagcgagtaaaaatgaagtatttgat
aaagtgatgattttcttttcaaaagatgtaccttatttatataccgcaattttagcagta
gtgtttgttttaggaattgtaaaaaacaaaggaaattacagaaagtctgttttcagcagc
tttgttataactgtaattaatttgatttttagttttgcaattggaaaattatattatgag
gatagaccttttgtccataataaggtgaacttattagtacagcattctaaggatgcttct
tttccaagtgatcatgctacagggacaatgagtatagccttgggacttagaaattataat
aaattaataagtagaattttaatattaatatcactgattgtaggtttttcaagagtttat
gtgggaaatcactatcctatggatgttttaggtgcatatataatggtttttgtaacaaac
tatatttataacttaaaattaagaaataaggttgaaaatctatacgaagcagttgaaaag
aagatttttagagtattaggtattaaatttcttatacaataa

DBGET integrated database retrieval system