KEGG   Clostridium acetobutylicum ATCC 824: CA_C2873Help
Entry
CA_C2873          CDS       T00056                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00071  Fatty acid degradation
cac00072  Synthesis and degradation of ketone bodies
cac00280  Valine, leucine and isoleucine degradation
cac00310  Lysine degradation
cac00362  Benzoate degradation
cac00620  Pyruvate metabolism
cac00630  Glyoxylate and dicarboxylate metabolism
cac00640  Propanoate metabolism
cac00650  Butanoate metabolism
cac00900  Terpenoid backbone biosynthesis
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
cac01120  Microbial metabolism in diverse environments
cac01130  Biosynthesis of antibiotics
cac01200  Carbon metabolism
cac01212  Fatty acid metabolism
cac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CA_C2873
   00630 Glyoxylate and dicarboxylate metabolism
    CA_C2873
   00640 Propanoate metabolism
    CA_C2873
   00650 Butanoate metabolism
    CA_C2873
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CA_C2873
   00072 Synthesis and degradation of ketone bodies
    CA_C2873
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CA_C2873
   00310 Lysine degradation
    CA_C2873
   00380 Tryptophan metabolism
    CA_C2873
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CA_C2873
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CA_C2873
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CA_C2873
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cac04147]
    CA_C2873
Enzymes [BR:cac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CA_C2873
Exosome [BR:cac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CA_C2873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 1119056
NCBI-ProteinID: NP_349476
UniProt: P45359
Structure
PDB: 

Position
complement(3005963..3007141)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIASAVRTAIGSYGKSLKDVPAVDLGATAIKEAVKKAGIKPEDVNEVILGNVLQAG
LGQNPARQASFKAGLPVEIPAMTINKVCGSGLRTVSLAAQIIKAGDADVIIAGGMENMSR
APYLANNARWGYRMGNAKFVDEMITDGLWDAFNDYHMGITAENIAERWNISREEQDEFAL
ASQKKAEEAIKSGQFKDEIVPVVIKGRKGETVVDTDEHPRFGSTIEGLAKLKPAFKKDGT
VTAGNASGLNDCAAVLVIMSAEKAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYATKAAI
EKAGWTVDELDLIESNEAFAAQSLAVAKDLKFDMNKVNVNGGAIALGHPIGASGARILVT
LVHAMQKRDAKKGLATLCIGGGQGTAILLEKC
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttgtaatagctagtgcagtaagaacagcgattggatcttatggaaagtct
cttaaggatgtaccagcagtagatttaggagctacagctataaaggaagcagttaaaaaa
gcaggaataaaaccagaggatgttaatgaagtcattttaggaaatgttcttcaagcaggt
ttaggacagaatccagcaagacaggcatcttttaaagcaggattaccagttgaaattcca
gctatgactattaataaggtttgtggttcaggacttagaacagttagcttagcagcacaa
attataaaagcaggagatgctgacgtaataatagcaggtggtatggaaaatatgtctaga
gctccttacttagcgaataacgctagatggggatatagaatgggaaacgctaaatttgtt
gatgaaatgatcactgacggattgtgggatgcatttaatgattaccacatgggaataaca
gcagaaaacatagctgagagatggaacatttcaagagaagaacaagatgagtttgctctt
gcatcacaaaaaaaagctgaagaagctataaaatcaggtcaatttaaagatgaaatagtt
cctgtagtaattaaaggcagaaagggagaaactgtagttgatacagatgagcaccctaga
tttggatcaactatagaaggacttgcaaaattaaaacctgccttcaaaaaagatggaaca
gttacagctggtaatgcatcaggattaaatgactgtgcagcagtacttgtaatcatgagt
gcagaaaaagctaaagagcttggagtaaaaccacttgctaagatagtttcttatggttca
gcaggagttgacccagcaataatgggatatggacctttctatgcaacaaaagcagctatt
gaaaaagcaggttggacagttgatgaattagatttaatagaatcaaatgaagcttttgca
gctcaaagtttagcagtagcaaaagatttaaaatttgatatgaataaagtaaatgtaaat
ggaggagctattgcccttggtcatccaattggagcatcaggtgcaagaatactcgttact
cttgtacacgcaatgcaaaaaagagatgcaaaaaaaggcttagcaactttatgtataggt
ggcggacaaggaacagcaatattgctagaaaagtgctag

DBGET integrated database retrieval system