KEGG   Clostridium acetobutylicum ATCC 824: CA_C3003Help
Entry
CA_C3003          CDS       T00056                                 

Gene name
thyA
Definition
(RefSeq) thymidylate synthase
  KO
K00560  thymidylate synthase [EC:2.1.1.45]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00240  Pyrimidine metabolism
cac00670  One carbon pool by folate
cac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cac00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CA_C3003 (thyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CA_C3003 (thyA)
Enzymes [BR:cac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     CA_C3003 (thyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylat_synt
Motif
Other DBs
NCBI-GeneID: 1119186
NCBI-ProteinID: NP_349604
UniProt: Q97EV3
Position
3140970..3141761
Genome map
AA seq 263 aa AA seqDB search
MSKADEKYLDIIENILENGYYDNNRTGIETYKLPHQIMQFDLSKEFPILTTKFVAFKTSV
KELLWIYKDQSNDVRKLQNENVTIWDEWMLEDGTIGKAYGYQVAKFKQIDNLIDTLKTDP
QSRRMLISLWNIADLKDMSLTPCCYETLWDVQNGKLNCMLVQRSGDMPLGVPFNMCQYAV
LVHLIAQVTGLKPGLFTHVINNAHIYKNQIEGMKIQLKRRDKAYEAPKLWINPNIKNFYD
FTADDIKLIDYKHHDKIKMEVAV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagctgatgaaaaatatttagatataatagaaaacattttagaaaatggttat
tatgataacaatagaacaggaattgaaacctataagcttcctcatcaaattatgcagttt
gacttgtccaaagagtttccaatactcacaacaaaatttgttgcttttaaaacttctgta
aaggagcttttgtggatatataaagatcaatcaaacgatgtgagaaaacttcaaaatgag
aatgttaccatatgggatgaatggatgctcgaagacggcactataggaaaagcttacggt
tatcaagtagctaaatttaaacaaattgacaatctaatagacaccttaaaaacggaccct
caaagtagacgaatgcttatatccttatggaatatagccgacttaaaggatatgtctctt
acaccttgctgctatgaaacactgtgggatgtacaaaatggcaaactaaattgtatgcta
gttcaaagaagtggtgacatgcctttaggtgtaccttttaatatgtgccaatatgcagtt
ttagtacatttaatagcccaggttactggccttaaaccaggtctctttactcatgtgata
aataatgctcatatatataaaaatcaaattgaaggtatgaaaattcaacttaaaagaaga
gataaggcatacgaagcaccaaagctgtggataaatcctaacattaaaaatttttatgat
tttacagctgatgacattaaattaatagattacaaacatcacgataaaataaaaatggag
gtggccgtgtaa

DBGET integrated database retrieval system