KEGG   Clostridium acetobutylicum ATCC 824: CA_C3157Help
Entry
CA_C3157          CDS       T00056                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00260  Glycine, serine and threonine metabolism
cac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
cac01130  Biosynthesis of antibiotics
cac01230  Biosynthesis of amino acids
Module
cac_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CA_C3157 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CA_C3157 (trpA)
Enzymes [BR:cac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CA_C3157 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA
Motif
Other DBs
NCBI-GeneID: 1119339
NCBI-ProteinID: NP_349754
UniProt: Q97EF6
Position
complement(3292089..3292880)
Genome map
AA seq 263 aa AA seqDB search
MANKIDLKFKELKYKNKKAMIPFVTSGYPDVETTKKIVIEMEKSGADLIELGIPYSDPVA
DGPIIQISSSGALNNGLKIKDIMNMVKEVRKNVKIPIVYMGYFGCVFKYGLEKFIKDSKE
SGVDGIVIPDLPLEERERVKEIADRYEFYIIPLVAPTSEDRIGKIVNGAKGFIYCVSTNG
VTGVRNIIANDVKAYIDVVSKASNVPKCIGFGISSPEMAQKMKEYCDGVIIGSAVMKIVE
EDIPKEEMIRKVGEFISQVNEVL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataaaattgatttgaaatttaaggagttaaaatataaaaacaaaaaagctatg
attccatttgttacaagtggatatcctgatgttgaaacgacaaagaaaatagttattgaa
atggagaaatccggagctgatttaatagagcttggaataccttactcagatcccgttgca
gatggtcctattatacaaatatcttcatctggagctcttaataatggacttaagataaag
gatataatgaatatggtaaaagaggtacgtaaaaatgttaaaataccaatagtctatatg
ggatactttggatgtgtttttaaatatggattagagaagtttattaaagattccaaagaa
tctggcgtagatggaatagtaataccagatttacctcttgaagaaagagaaagggtgaaa
gaaatagcagacagatatgaattttatataataccacttgtagcacctacttcagaggat
agaataggtaaaatagttaatggggccaagggctttatatattgtgtttctactaatgga
gttactggagttagaaatattatagctaatgatgttaaagcttatatagatgtagtttca
aaagcttcgaatgtacctaaatgcataggcttcggcatatctagtccagaaatggcacaa
aagatgaaagaatattgtgatggagttattataggaagtgctgttatgaaaattgttgag
gaggatataccaaaggaagagatgattcgtaaagtaggagaatttatttcacaggttaat
gaagtattataa

DBGET integrated database retrieval system