KEGG   Clostridium acetobutylicum ATCC 824: CA_C3158Help
Entry
CA_C3158          CDS       T00056                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00260  Glycine, serine and threonine metabolism
cac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
cac01130  Biosynthesis of antibiotics
cac01230  Biosynthesis of amino acids
Module
cac_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CA_C3158 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CA_C3158 (trpB)
Enzymes [BR:cac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CA_C3158 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 1119340
NCBI-ProteinID: NP_349755
UniProt: Q97EF5
Position
complement(3292870..3294054)
Genome map
AA seq 394 aa AA seqDB search
MNGRFGKFGGQYVPETLMNAINELEVEFNKAINDEKFMMEYKYYLEKYVGRETPLYFAEN
MTKNLGGAKIYLKREDLNHTGSHKLNNALGQVLLAKRMGKKRVIAETGAGQHGVATATAA
ALFGLECEVFMGAEDVERQALNVFRMKILGAKVNSVKSGTNTLKDAINAAMRDWVTNIDN
TYYVIGSVMGPHPYPTIVKDFQKIIGEEARKQILKAEGRLPDYVVACVGGGSNSMGIFYP
FIKDEGVKLIGVEAAGLGIDTPMHAATLTKGSVGIIHGMMTYVLQDEDGQITPAYSVSAG
LDYPGVGPQHSYLKEKERASYEAVTDKEALKAFLYLSEKEGIIPALESSHAVAYAMKLAP
SLSKDEIVIINLSGRGDKDVNTVMKNMEENKNGK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaagatttggaaaatttggaggacagtatgttccagagacattaatgaatgca
ataaatgaacttgaggttgaatttaataaggcaataaatgatgaaaaatttatgatggaa
tacaagtattatcttgaaaaatatgttggaagagaaacaccactatattttgctgaaaac
atgacaaagaatcttggtggagcaaaaatatatctaaaaagagaggatttaaatcataca
ggttcccataagttaaataatgctttaggacaagtacttttggcaaagagaatgggaaaa
aagagagtcatagcagaaacaggagcaggacagcatggagttgctacggctacagcagca
gctttgtttggattagaatgtgaagtgtttatgggagcagaagatgttgaaaggcaagcg
cttaatgtgtttagaatgaagatattaggagcaaaagtgaattcagtaaaatcgggcact
aatactttaaaggatgcaataaacgcagctatgagagattgggttacgaatatagacaat
acttactatgtaataggttcagtaatgggtccgcatccgtatccaactatagtaaaagac
tttcaaaagattataggagaagaggctagaaagcagatattaaaagcagaaggaagactt
ccagactatgttgttgcatgtgtaggagggggaagtaactccatgggtatattttatcct
tttattaaggatgaaggagtgaagcttataggtgttgaagcagctgggctcgggattgat
actccaatgcatgcggcaacgcttacaaaaggaagtgtaggtataatacatggaatgatg
acttatgtgcttcaagacgaagatggtcaaataactccagcatattcagtatctgcgggg
cttgattatccaggagtgggaccacagcattcttacttaaaggaaaaagaaagagcaagc
tatgaggctgtaactgataaagaagccttaaaggcgtttttgtatttatcggaaaaggaa
ggaataatacctgcgcttgagagttctcatgcagtagcctatgctatgaaactggcacct
agcctatcaaaagatgagattgttattataaatctttctggaagaggagataaggatgta
aatactgtaatgaaaaatatggaggaaaataaaaatggcaaataa

DBGET integrated database retrieval system