KEGG   Clostridium acetobutylicum ATCC 824: CA_C3229Help
Entry
CA_C3229          CDS       T00056                                 

Definition
(RefSeq) NADPH dehydrogenase NamA
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
cac  Clostridium acetobutylicum ATCC 824
Brite
KEGG Orthology (KO) [BR:cac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CA_C3229
Enzymes [BR:cac01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     CA_C3229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN G3P_antiterm Dus
Motif
Other DBs
NCBI-GeneID: 1119411
NCBI-ProteinID: NP_349824
UniProt: Q97E86
Position
3377589..3378608
Genome map
AA seq 339 aa AA seqDB search
MKIFEAYTIKNMCLKNRIVMPPMCMYSSDNTGNINDFHLVHYTTRSIGGVGFIIVEATGI
TPNGRISDKDLGIWSEKHAEGLSFLVKEVKKYGSKIAIQLNHSGRKYEGTSGEPVAPSAL
AFDENSKTPKELTKNEIKEIILAFKAAAKRAEKAGFDAIEIHGAHGYLINQFLSPLSNFR
DDEYGGSTENRTRFLKEVLEAVREVWPKEKPILLRVSAEDYRGGSGITPNEMVNIINIVK
DLIDVVDVSSGGVAPAHINLYPGYQVKLSEVIKNECNVPTIAVGLICDINMVEEILSNNR
ADLVALGRELLRNPYFVLSSARLKNINIDFPKPYERAFN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatatttgaagcatatactataaagaacatgtgtttaaaaaatagaattgtaatg
ccacctatgtgcatgtattcttctgataatacaggtaatataaatgattttcatttagta
cattatactacacgatctataggcggtgtaggttttataatagtagaagccactggcatt
acacccaacggtagaataagcgataaagatttaggaatatggagtgaaaaacatgcagag
gggttaagctttttagtaaaggaagttaaaaagtatggttcgaaaatagccatacaatta
aatcacagtggaagaaaatatgaaggcacttctggtgaacctgttgctccaagcgcatta
gcctttgatgaaaacagcaaaacgccaaaagagctcactaaaaatgagattaaagaaata
attttggcatttaaagctgccgctaaaagagctgaaaaagccggttttgatgctatagaa
atacatggagctcatggctacctcataaaccaatttctttctcctctatcaaactttagg
gacgatgaatacggcggaagcaccgaaaatagaaccagatttctaaaagaagtattggaa
gctgtaagagaagtatggcctaaagaaaaacctatacttttgagagtttctgctgaagac
tatagaggcggctctggaataactccaaatgagatggttaacattataaatatagtaaaa
gatctaatagatgttgttgatgtaagctctggtggagttgctcctgcacacataaactta
tatccaggttatcaagtaaaattgtctgaagttataaagaatgagtgcaacgtaccaact
atagctgtaggacttatatgtgatataaatatggtagaggaaattctttcaaataaccgt
gctgatcttgtagctcttggaagagaacttttaagaaatccttacttcgtattaagttca
gcaagacttaagaatataaatatagattttccaaagccttatgaaagagctttcaattag

DBGET integrated database retrieval system