KEGG   Clostridium aceticum: CACET_c00600Help
Entry
CACET_c00600      CDS       T03971                                 

Gene name
cbiT
Definition
(GenBank) precorrin-6Y C(5,15)-methyltransferase
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
cace  Clostridium aceticum
Pathway
cace00860  Porphyrin and chlorophyll metabolism
cace01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cace00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CACET_c00600 (cbiT)
Enzymes [BR:cace01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     CACET_c00600 (cbiT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 GidB Cons_hypoth95 Methyltransf_25 PrmA DOT1 MTS DUF2442 PCMT Methyltr_RsmB-F Methyltransf_18 Methyltransf_4 GCD14 FtsJ Methyltransf_11 Methyltransf_15 Met_10 UPF0020 Methyltransf_12 Ubie_methyltran Methyltransf_24 V_cholerae_RfbT CMAS
Motif
Other DBs
NCBI-ProteinID: AKL93578
UniProt: A0A0D8IA42
Position
58521..59114
Genome map
AA seq 197 aa AA seqDB search
MDKKWEYNGFGIPDDYFVRGKAPMTKEEVRAVVLGKLRLKEDHIFVDVGAGTGSVSIEAA
LKLSKGKVYAIEYKEEALNLLAVNGKAFGVENLEILKGRAEEELKKITYFDRVFVGGSGG
EIHWIIDYALEHLSEEGRIVVTAVTLETLTEAFKALKTKEFKDVEVVSVSVSKGRSTGNY
TLMEAQNNIYVLSATKR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaatgggaatacaatgggttcggcataccagatgattactttgtaagggga
aaggcccccatgacaaaggaagaagtaagggcagtggtactgggaaaactaaggttaaaa
gaggatcacatttttgtggatgtaggagcaggtactggttcggtatctatagaagcagct
ttaaaattatctaaaggaaaagtctatgccatcgaatataaggaggaagcccttaacttg
ctggcagtcaacggcaaggcttttggggtagaaaacttagagatactaaagggccgtgct
gaagaagagttgaaaaaaatcacatactttgatagagtttttgtcggtggaagtggtgga
gaaatacattggattatagattatgcattagaacatctttctgaagaaggaagaatagtt
gttactgcagtcacccttgaaaccttaacagaagcctttaaagctttgaaaacaaaggag
tttaaggatgtagaagtagtatcagtaagtgtttctaaagggcgttccacgggaaactat
accttgatggaagctcaaaataatatctatgttctttctgctacaaaaaggtaa

DBGET integrated database retrieval system