KEGG   Clostridium aceticum: CACET_c04300Help
Entry
CACET_c04300      CDS       T03971                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase ThlA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cace  Clostridium aceticum
Pathway
cace00071  Fatty acid degradation
cace00280  Valine, leucine and isoleucine degradation
cace00310  Lysine degradation
cace00362  Benzoate degradation
cace00380  Tryptophan metabolism
cace00620  Pyruvate metabolism
cace00630  Glyoxylate and dicarboxylate metabolism
cace00640  Propanoate metabolism
cace00650  Butanoate metabolism
cace00900  Terpenoid backbone biosynthesis
cace01100  Metabolic pathways
cace01110  Biosynthesis of secondary metabolites
cace01120  Microbial metabolism in diverse environments
cace01130  Biosynthesis of antibiotics
cace01200  Carbon metabolism
cace01212  Fatty acid metabolism
cace02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CACET_c04300 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    CACET_c04300 (thlA)
   00640 Propanoate metabolism
    CACET_c04300 (thlA)
   00650 Butanoate metabolism
    CACET_c04300 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CACET_c04300 (thlA)
   00072 Synthesis and degradation of ketone bodies
    CACET_c04300 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CACET_c04300 (thlA)
   00310 Lysine degradation
    CACET_c04300 (thlA)
   00380 Tryptophan metabolism
    CACET_c04300 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CACET_c04300 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CACET_c04300 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CACET_c04300 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cace04147]
    CACET_c04300 (thlA)
Enzymes [BR:cace01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CACET_c04300 (thlA)
Exosome [BR:cace04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CACET_c04300 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKL93946
UniProt: A0A0D8IF02
Position
458622..459800
Genome map
AA seq 392 aa AA seqDB search
MREIVIVGAARTPIGNFGGSLAKMSAVELGVIAAKEATKRAGITGEMIDEVIVGNVLSAG
LGQNIARQIAIKSGLPETTSAMTINKVCGSGLRAVSLAAQIIQSGDAEIVLAGGTESMSN
APYLLDQARWGNKMGHSNVIDSIIQDGLWDAYNNYHMGITAENIAEKWQISREEQDEFAA
KSQSKAEMAVKDGNFKEEIVPVVLPQKKGDPIVFDTDEYPKFGTTVESLKKLKPAFKKDG
TVTAGNASGINDGAAMLVVMSKEKAEELGLKPLAKIKAYASDGLDPSIMGYGPVPATKKA
LKKAGMTVDDLDLIEANEAFAAQSLAVAKDLGLDPSKINVNGGAIALGHPIGASGARILV
TLLYEMNKREAKTGLATLCIGGGMGTALIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaatcgtaattgttggtgcagctagaacgccaatcgggaattttggtggcagc
cttgctaagatgtcagcagtagagttaggtgttatagctgctaaagaagcaacaaaaaga
gctggtatcactggagagatgattgatgaagtgatcgtagggaatgtactgtcggctgga
ctaggacaaaatatagcaagacagattgcaataaaaagtgggttaccggaaacaacctca
gcaatgactattaataaagtttgtggttcaggacttcgtgctgtaagtttagcagctcaa
atcatccaatcaggagatgcagaaattgtcttagcaggagggactgagagcatgagcaat
gctccctacttactggaccaagcaagatggggtaataaaatgggtcacagcaatgttatt
gactccataatccaagatgggctttgggacgcatataacaactatcatatgggtataacc
gctgaaaatatcgctgaaaagtggcagatatcaagagaagaacaggatgagtttgcagct
aaaagccaatcaaaggcagagatggcagtaaaggatggaaattttaaagaggaaattgtc
cctgttgttcttccacagaaaaagggagatcccatcgtttttgatacggatgaataccct
aagtttggtactacagtggaaagcttaaaaaaattaaaacctgcttttaaaaaggatgga
acggtaacagcaggaaatgcttctggtattaatgatggagccgctatgttggtggtaatg
tctaaagagaaggcagaagaactaggattaaagccgcttgcaaaaatcaaagcctatgca
tctgatggactagatccaagcattatgggatatggaccagtaccagcaacaaaaaaagcc
ctgaaaaaggcaggaatgacagtagatgatttagacttgatcgaagccaacgaagccttt
gcagcacaatccttagctgtggcaaaggacctaggattagatccgtctaaaatcaatgta
aacggtggagccattgctctggggcatcctattggggcatcgggggcaaggattctggta
acgttgctctatgagatgaataaaagagaggctaaaacaggattagcaaccctatgtatt
ggtgggggaatgggaacagccttgatcgtggaaagataa

DBGET integrated database retrieval system